CAZyme Information: SPSK_02235-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_02235-t39_1-p1
• CAZy Family: CBM67|GH78
• CAZyme Description: beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		96168.01	5.5221

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000006:96412-99070(+)

Full Sequence      

MAVIAIHQAEQGQRHVPKTLSGWKWRQLDKQQEWTACAHDKPITEIFTDLIDAGRIPDPF
LDENEKLVQWVGEADWEYECSFKAVARSARQVLVFDGLDTFAAVYLNDQLILESDNMFHT
HRVDVHGTLRDGANSLLIVFRSALNQGKAIEAKLGKLTCFNGDSSRVYVRKAQYHYGWDW
GPTFLTCGPYREIRLETYDAAVLYDVFANAVVSDDLQQAKLDITFAADVPKSVIVQATVT
SPSGKTVPLATSLVAGATNGSVSTTIAQPELWYPINHGPQAFYTVKLEVYAAGNDTATSP
TVLATSRTRIGIRRARLVQEPLLDAPGTSFYFEVNNEAVYVSGSNWIPRHSFLTALTDAD
YRQSVDECVASNQNMLRVWGGGLYEHDAFYDQCDERGVLVWQDFMFACGQYPCHDTFEAS
VRREAEDQVRRMRRFCSIVLYAGNNEDYQVAEQIGLDWDQDDNSGNWTTTNFPARYLYER
TLPAVVAALNAQVPYHPGSPWGGINTEDATMGDIHMWHVWHGTQEPYQNWPKLTGRFVSE
FGMLAFPARRSVERYVTDPAQRYPQSSVLDLHNKAGGGERRLGSYILENLRLKSVDLDAW
IYASQLVQAECLASAIRSCRRQWKGRRREYCGGQLVWQINDCWPVSSWALIDFYGERKLA
FYAVKRHSAPLVVDLGRTYVSVEEGKNTLEALKPRRAHIDVWAANASLSQYVSDVTVTMF
DIVSGTVVSTRKLKSESLAANETTELLHGLAVDDKTAVQAVVRDASTGAVLSRASDWPQP
LKHVALATSQDSGVQVTVLDNRVEITSKVPIKGLELSLSADKAVTWSDNGVDVFPGDVYS
IDAPGLSRTDTVDVRYYGLH

Enzyme Prediction     

EC	3.2.1.25:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	44	779	6.4e-81	0.6821808510638298

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225789	LacZ	2.03e-64	18	665	13	627	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
395572	Glyco_hydro_2	2.39e-08	205	313	5	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
407658	Mannosidase_ig	6.67e-07	699	783	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI21799.1|GH2	0.0	18	858	6	846
ANB14378.1|GH2	7.71e-281	19	857	13	859
QOU19887.1|GH2	4.78e-257	19	859	6	844
SGZ48501.1|GH2	2.80e-251	19	857	6	833
SGZ52529.1|GH2	5.61e-251	19	857	6	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	3.40e-127	18	841	36	808	Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	7.35e-106	21	674	13	657	Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	7.69e-106	21	674	15	659	Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	7.86e-106	21	674	15	659	Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
6BYE_A	1.02e-105	48	841	43	830	Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I2C092|MANBB_THETO	5.17e-243	23	859	13	854	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
sp|Q2TXB7|MANBB_ASPOR	2.18e-195	21	858	11	843	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
sp|B8NW36|MANBB_ASPFN	1.72e-194	21	858	11	843	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
sp|Q5B7W2|MANBB_EMENI	6.52e-191	22	850	12	833	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
sp|A1CGA8|MANBB_ASPCL	4.32e-189	22	850	12	835	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in SPSK_02235-t39_1-p1.