CAZyme Information: SPSK_01951-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01951-t39_1-p1
• CAZy Family: AA9
• CAZyme Description: endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
234	AXCR01000005|CGC2	24946.42	8.9292

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:2203075-2203779(-)

Full Sequence      

MGIFSALVLGLAAVATANPMPVAGPALPLPGSGLVGSRTVEERSTPTGTGTNNGFFYSFW
TDGQGSVTYNNGPAGEYSVQWNNVNNFVAGKGWNPGSPRTVNYTGTWNGRNVNSYLSLYG
WTKSPLVEYYIVESYGTYNPSTGGTKKGTVTSDGGTYDIYLNKRVNQPSISGTATFDQYW
SVRQSRRVGGTVTVKNHFDAWAKAGLQLGSHDYQIIATEGYQSSGSADITVSQG

Enzyme Prediction     

EC	3.2.1.8:67

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	53	230	1.3e-76	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	7.01e-109	53	228	1	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABG33753.1|GH11|3.2.1.8	5.46e-110	7	231	9	228
CAE7188246.1|GH11	1.28e-108	7	232	9	229
AGI96769.1|GH11	1.28e-108	7	232	9	229
ABY61040.1|GH11	3.09e-108	43	233	25	215
AUS45845.1|GH11	1.54e-107	5	231	5	228

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H1A_A	7.29e-88	45	231	4	190	Chain A, Endo-1,4-beta-xylanase [Thermochaetoides thermophila],1H1A_B Chain B, Endo-1,4-beta-xylanase [Thermochaetoides thermophila]
1XNK_A	8.64e-88	45	231	4	190	Chain A, endoxylanase 11A [Thermochaetoides thermophila],1XNK_B Chain B, endoxylanase 11A [Thermochaetoides thermophila]
4XQD_A	2.76e-87	48	232	5	189	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],4XQD_B Chain B, Endo-1,4-beta-xylanase 2 [Trichoderma reesei],5ZF3_A Crystal Structures of Endo-beta-1,4-xylanase II Complexed with Xylotriose [Trichoderma reesei RUT C-30],5ZH0_A Crystal Structures of Endo-beta-1,4-xylanase II [Trichoderma reesei RUT C-30],5ZO0_A Neutron structure of xylanase at pD5.4 [Trichoderma reesei RUT C-30]
2JIC_A	2.86e-87	48	232	6	190	High resolution structure of xylanase-II from one micron beam experiment [Trichoderma longibrachiatum]
5K7P_A	2.86e-87	48	232	6	190	Chain A, Endo-1,4-beta-xylanase 2 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CFS3|XYNA_ASPTN	1.43e-98	42	231	42	230	Probable endo-1,4-beta-xylanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xlnA PE=3 SV=1
sp|P48824|XYNB_ASPKW	1.35e-97	40	231	34	224	Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=xlnB PE=3 SV=2
sp|A1DNU5|XYNB_NEOFI	4.77e-97	4	232	4	221	Probable endo-1,4-beta-xylanase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=xlnB PE=3 SV=1
sp|P55332|XYNA_EMENI	7.76e-97	42	231	36	224	Endo-1,4-beta-xylanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xlnA PE=1 SV=1
sp|P55330|XYNB_ASPNG	1.56e-96	40	231	34	224	Endo-1,4-beta-xylanase B OS=Aspergillus niger OX=5061 GN=xlnB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000256	0.999701	CS pos: 17-18. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01951-t39_1-p1.