CAZyme Information: SPSK_01846-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01846-t39_1-p1
• CAZy Family: AA9
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	AXCR01000005|CGC9	30758.00	8.0402

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:2307820-2308844(+)

Full Sequence      

MLFWSLATVVASAAFAAGASLKPVTSFGANPTSIQMYLYVPDKVAEKPAVIVALHPCGGS
ATGWYSQTKLPSYADKNGFILIYPGTTHMSNCWDVQNPASLTHNGGGDAGGIISMVNYTL
AKYNGDASKVYVMGGSSGAMMTNVMAGSYPDVFEAGAAFSGVAHACFAGAAGATPMSPNQ
TCAQGQISHSAKQWGDFVRNSYPGYTGRRPRMQIFHGLADTLVRPACAEQALLQWSNVLG
VELTKNVTGVPSAAYTQEIYGDGTKLQGFFGKGVGHIAPVNEPLMLKFFGITQ

Enzyme Prediction     

No EC number prediction in SPSK_01846-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	33	194	1.1e-24	0.6079295154185022

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	4.80e-42	36	249	1	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	3.78e-23	26	194	39	231	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	1.41e-20	38	234	5	194	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	2.04e-07	36	162	382	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
395257	Peptidase_S9	1.15e-06	71	163	7	99	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO57203.1|CE1	7.69e-168	5	293	6	294
API68922.1|CE1	2.20e-167	5	293	6	294
QBZ57428.1|CE1	3.59e-161	1	291	1	290
CAE75726.1|CE1	1.33e-149	19	293	19	292
VBB78227.1|CE1	1.33e-149	1	291	1	290

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.30e-78	20	292	3	275	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HGR3|FAEB_NEUCR	2.36e-150	19	293	19	292	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|G2QND5|FAEB_MYCTT	2.40e-145	13	291	13	290	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	6.60e-108	1	292	8	292	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	3.68e-106	1	293	8	293	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|Q4WBW4|AXE1_ASPFU	9.70e-79	20	292	33	305	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001235	0.998725	CS pos: 16-17. Pr: 0.9454

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01846-t39_1-p1.