CAZyme Information: SPSK_01729-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01729-t39_1-p1
• CAZy Family: AA9
• CAZyme Description: fungal cellulose binding protein domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446		46771.34	7.1025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:76035-77438(-)

Full Sequence      

MTAGEAAPAPAPAAGGSGLGPGTGKGSYLPPLYLPWVPAAVMVVVIVSFFTHRRGSIRSP
HNLGLADQKSESLLPSFLSSFSNSGSNRPRRHPRRPSSSSCISSLVAAVAYFAAAVAIVV
LVLAAMHSLRQFAAHAAVASSVAGGLAFGAPSPASWSGSVPKASTCDATSQWPGWKGIQY
AFIFGDSYTQTGFNYSITPTPSIDNPLGNPPYPGWTSSNGPNWVGFLSTKYNASRLRTYN
LAYGGATVDSDIVQPYRPTVLSMKDQVHSEFLPGFTNHGNSDTDVSETHPSAPNAPAWQG
NDTLFAIWIGINDVGNSYHHGVDGVNGTTEINRRIFEVYGDMVGMLYNAGGRNFVFLTVP
PVDRSPLTAAGGDAAAQALEKADIAAFNSLLKDGLAADLKSQHADHANVWVVDTGLVFNA
AMDDPASFPQTAGLKNTTSFCAAYGK

Enzyme Prediction     

No EC number prediction in SPSK_01729-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	183	436	3e-61	0.8539325842696629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	3.44e-52	182	444	3	231	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	1.84e-10	182	445	4	269	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
225780	COG3240	7.89e-10	146	441	8	285	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238883	Triacylglycerol_lipase_like	2.82e-06	182	438	5	231	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	0.003	182	418	2	193	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATZ46260.1|CE16	1.59e-85	166	444	32	289
APA06788.1|CE16	3.97e-83	166	444	32	289
CBY01773.1|CE16	3.21e-79	167	444	26	280
UJO22905.1|CE16	5.88e-78	172	444	34	283
CAE7178865.1|CE16	1.27e-76	163	444	17	277

PDB Hits     

SPSK_01729-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G2QJ27|AES1_MYCTT	1.16e-50	179	428	32	258	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	3.39e-49	179	428	32	258	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000020

TMHMM  Annotations     

Start	End
28	50
101	123