CAZyme Information: SPSK_01659-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01659-t39_1-p1
• CAZy Family: AA9
• CAZyme Description: mannan endo-1,6-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460		49304.52	4.7921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:1408913-1410526(+)

Full Sequence      

MLLVKAAFLAAVVAAADAVAPADLSVNKTDSIIGVANTLAKGAMSYYSGNASSFADLPDP
YYWWEAGALMGAMLDYSYYTNDTTYDDIVATAILQNTGPAHDFIVPAHELDEGNDDQAFW
GFTVLTAAEHNFTQPAELTPKGVPSWLDLSINVWNNMVVRWNTTKCAGGFTWQIYADNFN
GMNYKNSASNGGFFLISARLALLTGNKTYVDWAQKVWDWTDAVGIIDKHYNVYDGTDSAT
NCTQINLLSFSYQNGIFLYGAAVLANHTGDAVWKTRAEGLLDAARHFFSPDKNATNIMWE
HACEGVGTCTKDMKTFKGFLSRFMYSAVQVLPSLAPNVTAYMRASATAAGKACTGANIDG
APTQNGTTCGQKWYVGGFDGSVGLGQEMCALETVQGLLGLNKVLGIDQAPPPSPSPTAPA
PAPSPSGDKTKNASPRGMSHIDLRWTVVSMACALFAYGMA

Enzyme Prediction     

No EC number prediction in SPSK_01659-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	29	398	3.4e-86	0.9273743016759777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	4.51e-139	31	391	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	2.07e-12	139	362	113	317	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO60662.1|GH76	1.88e-169	11	398	12	388
AEO70787.1|GH76	6.41e-168	14	398	15	388
VBB73902.1|GH76	4.27e-152	18	401	19	391
CDP24660.1|GH76	6.05e-152	18	401	19	391
CAP67249.1|GH76	6.05e-152	18	401	19	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.04e-76	26	398	30	403	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	6.77e-96	23	402	23	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q75DG6|DCW1_ASHGO	6.33e-94	23	402	23	391	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|Q6FLP9|DCW1_CANGA	6.08e-93	23	411	20	389	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|O74556|YCZ2_SCHPO	2.95e-89	24	403	22	389	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q5AD78|DCW1_CANAL	7.51e-86	24	398	21	388	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000326	0.999654	CS pos: 18-19. Pr: 0.9495

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01659-t39_1-p1.