CAZyme Information: SPSK_01526-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01526-t39_1-p1
• CAZy Family: AA8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
647		69914.07	5.4141

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:159369-161521(+)

Full Sequence      

MWPFSEAYPERKVGDVDGETFDYIVVGGGTAGSVVASRLSEDPSVSVLLLERGPLKDVFM
SRIPLLSQNFTSSWSTGVQDRFSEPIAGYNDRRLQLSGGEGLGGTSRLNGLLVTRGAPGG
YNEWASDLGLDGWAWDDIEPYFERMEAAVDRRDADHRGQEGRQGKAHGASFEKACKAVGL
PVETDCNAPAASAQGYFSLDAAVYQDGTRVSAYRAYLNKRIALERRGRLTICTEALVTKL
ELNDGVVPDSDSADARATGVYVASAPTDQDEIGKPVLVKARREIIVCGGAFRTPQLLLLS
GLGPRAHLQEKGIPVVRDLPAVGQHLSDHFGIPIMIQLPVMDTAHSVIEKPLVGIRSFVE
YLWSGSGLLSMPSNTTTIFARTTAMDETTYRTSETPALNDATRPGNVPDVELMLIPVNAI
NLEAIGCAPHAATQGRGFLTLYTTMVQLRTTGHLELVSTTDPKAHARVHYPEMVDDDGVG
KDDWAAVRRAVRFTMRLADEFVQNSGYPQKPAAILFGPGMDMDILRDVTKGRPGERQTTP
TATAPTPSESGDIQPLEKTWKTVTDAEIDAYVRETGQTGLHFCCTARMAPTAKDGVVDAR
LKVHGVSGLRIADASVFPRIPSGHTMVPSLMVGERCADFIKAAWAGQ

Enzyme Prediction     

No EC number prediction in SPSK_01526-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	20	642	1.5e-134	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.79e-98	19	641	4	532	choline dehydrogenase; Validated
225186	BetA	5.41e-86	18	643	5	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
366272	GMC_oxred_N	3.55e-31	90	329	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	8.31e-26	564	636	71	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.80e-18	19	367	54	362	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYS92880.1|AA3_2	4.63e-169	1	644	1	615
QBZ58631.1|AA3_2	2.47e-148	2	644	3	656
UKZ47954.1|AA3	2.42e-134	8	644	1325	1914
VBB80495.1|AA3_2	4.56e-119	8	640	50	668
CDP28838.1|AA3_2	2.52e-118	22	640	64	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AV4_AAA	3.31e-53	16	640	79	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS2_AAA	3.57e-53	16	640	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	3.57e-53	16	640	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	3.57e-53	16	640	3	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	4.68e-53	16	640	19	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q47944|SDH_GLUOY	1.32e-59	21	641	5	528	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1
sp|Q9L4K0|BETA2_CHRSD	8.02e-57	21	641	7	534	Oxygen-dependent choline dehydrogenase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=betA PE=3 SV=1
sp|A6U6Y8|BETA_SINMW	1.78e-56	22	640	4	525	Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) OX=366394 GN=betA PE=3 SV=1
sp|P54223|BETA_RHIME	2.46e-56	22	640	4	525	Oxygen-dependent choline dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=betA PE=3 SV=2
sp|A0A3B1EFP9|STR4_STRTC	4.33e-56	19	641	34	612	Dehydrogenase str4 OS=Strobilurus tenacellus OX=41251 GN=str4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999977	0.000058

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01526-t39_1-p1.