CAZyme Information: SPSK_01406-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01406-t39_1-p1
• CAZy Family: AA7
• CAZyme Description: beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1126		122616.97	6.0049

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000005:1325929-1329309(-)

Full Sequence      

MSSLVSSSSSSSPVYTPSHSRTPSPPTHAMGLPRQEVPGRHDYENEAVVRRNALPHRTYY
LPPEATLCLNGSDGEWQFHYADSPLNAPDAAAASSSSPDSGDGWSPITVPGHWQLEGRLR
GHGDAWGIPHYTNVQYPIPVAPPYVPATNPTGTYRRVFSVPSSWAEQFPGDGGPRLRLRF
DGVDSAYHVWGNGSLVGYAQGSRNAAEFDITEAVAAAAHTQEVTLVVQVYQWSDGSYIED
QDQWWLSGIFRDVHLLGFSATTSIDDWFVHTDLDATYTDAVLRGAVTVRTVEPSTLSLRL
LDKENASALVGETSVHVHAGATAPTTVEIALPVTSPRKWTAETPYLYRVELTLRPVSGND
RPHTVHQTVGFRQVELLNGLLCVNGVSLRLRGTNHHEHHPLHGRAVPDDFMRHDLLQIKQ
YNLNALRCSHYPPHPRLLDLADELGLWVIDEADLECHGFYDVVARPLDIPEEMDYEERKK
LTFPKAAAFTSDNPSWRAAYLDRMEAMVQRDKNHASIIVWSLGNEAFYGRNHKDMYHYAK
TVDPSRPVHYEGDAHAETADMYSYMYPSVERLAKLAETEGVDPKTGRYEKPVILCEYAHA
MGNGPGGLADYEDLFRTHPRVQGGFIWEWANHGLWKDDGGGKAYYAYGGNFGDEPNDGTF
VMDGLCNSQHQPTPGLVELKTVVQPVRVSLGSGADNRTLTIQNLYDFIDLSHLALSYRIE
DFSSGDSHSHVLFASRELALPHIAPHGGKGTVVLDGIDYSAYKDNADVLLTVLLSRKGAE
SGWKDVAHFQQYLIAAEKSHLATVPLSNVLSATTQTATVQQVGSTITASVGQHALVFSAV
RGSLTSWTVRSGGKSVVVLGSTNAASTLPALAPGFWRAPTDNDRPVSVPYWKRFGVDTLG
LHRVVSVDHAISGETATVTIETVMAAPVLGWGWTCRTVYTLSAGGLAVAVALTPFGSAPD
HVPRIGLDVRANKSLQNFAWYGQGPGESYPDKNRSLRVGVYEASLAGLQVPYDVPQENGN
RMGTRWMTAAARDGPLRLRATLSDAPENEGRAPSFSWAAGPYSAQVLDAAAHPCDLVGQE
DPDAVLLRLDARVAGVGSAACGPGVRPDLLAAVEPVSFAFSLAATV

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	73	997	1.3e-197	0.9534574468085106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236673	ebgA	0.0	43	1122	4	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
236548	lacZ	0.0	25	1110	1	1012	beta-galactosidase.
225789	LacZ	1.79e-138	73	991	16	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	8.46e-118	374	686	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	1.06e-72	835	1122	7	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53731.1|GH2	0.0	31	1122	5	1075
QBZ58582.1|GH2	0.0	32	1122	6	1041
DAA35009.1|GH2	0.0	27	1122	4	1067
UNI24272.1|GH2	0.0	31	1122	14	1057
UPK99756.1|GH2	0.0	31	1120	11	1044

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	1.64e-219	45	1123	18	1030	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6ETZ_A	2.59e-165	51	1105	21	968	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	4.52e-165	51	1105	42	989	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
1YQ2_A	4.66e-165	54	1108	21	1007	Chain A, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_B Chain B, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_C Chain C, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_D Chain D, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_E Chain E, beta-galactosidase [Arthrobacter sp. C2-2],1YQ2_F Chain F, beta-galactosidase [Arthrobacter sp. C2-2]
6ZJP_A	1.24e-164	51	1105	42	989	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	6.84e-219	45	1123	11	1023	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	5.50e-164	43	1122	4	997	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|B4S2K9|BGAL_ALTMD	2.01e-163	36	1097	6	1011	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
sp|Q59140|BGAL_ARTSB	3.94e-163	54	1108	17	998	Beta-galactosidase OS=Arthrobacter sp. (strain B7) OX=86041 GN=lacZ PE=1 SV=1
sp|P81650|BGAL_PSEHA	6.22e-153	35	1097	5	1007	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000019

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01406-t39_1-p1.