CAZyme Information: SPSK_01110-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_01110-t39_1-p1
• CAZy Family: AA7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576	AXCR01000011|CGC5	61907.60	8.3466

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000011:879591-881321(+)

Full Sequence      

MKVLVSTYPYAGHFNPTQPVICELVRRGHDVVWMTGPVYEARVRQTGARFVPMSPDALID
DEHIHVIHGKVTLAKVADYLRRLFLDRIPAQVRDYEGVAAAADGFVPDVLVVDFCTYAAR
CYMDRAGLPYATLGINPLVTLDPEIPPWGSGEQPPRTAGGRLRNRVRHALGIVFFISRLS
AALNKQRRALGLPPRSRWRSYADDVRSPDLHIMMTTPAFEFPRKNMLRSVVFVGPLLPSW
LDGDKKAVEDSSEAGTKAAGNASTGAAGAEPSDENAASADAVQPTDNTPPANDVQLADTT
PPWWDEMLAHPRERVVHLTQGTIATNTDLLVKPTVEALADRDDLLVIVTGKNVEAMFKSD
PPAGTAMASHSGPNVETVEAVQGVDTAAVPESPKIKRPANVRTAAFVPHLRLLPHVGVMV
TNAGYNGVLAALSCGVPLVCAGRTEDKADVSSRVAWSGAGIDLATAAPTAAAVRAAVLRI
VDSDAPARAPRNKKKGGPLALHPPGHDYRAVAARIRDDFARHNGPAEAVDALEALVKQKA
QEKAVAETLGRMDSTTKRKRLQPKPLRDSMAESAQS

Enzyme Prediction     

EC	2.4.1.-:6	2.4.1.-:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	21	536	3.5e-30	0.9607329842931938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.24e-30	1	535	1	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	6.67e-24	1	543	2	406	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
273616	MGT	3.01e-20	9	537	4	391	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
278624	UDPGT	8.08e-04	396	461	315	386	UDP-glucoronosyl and UDP-glucosyl transferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC86620.1|GT1	1.36e-135	1	538	1	435
QSQ26671.1|GT1	7.20e-69	2	537	3	425
UAB92889.1|GT1	2.49e-66	4	537	5	419
QGV10609.1|GT1	1.35e-63	2	539	3	416
AJQ62814.1|GT1	3.70e-63	2	539	3	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M83_A	5.70e-07	12	136	19	134	Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus],4M83_B Ensemble refinement of protein crystal structure (2IYF) of macrolide glycosyltransferases OleD complexed with UDP and Erythromycin A [Streptomyces antibioticus]
4M60_A	5.74e-07	12	136	22	137	Crystal structure of macrolide glycosyltransferases OleD [Streptomyces antibioticus],4M7P_A Ensemble refinement of protein crystal structure of macrolide glycosyltransferases OleD [Streptomyces antibioticus]
2IYF_A	2.31e-06	12	136	19	134	The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYF_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
6J31_A	2.94e-06	3	129	7	123	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	2.96e-06	3	129	10	126	Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8KHE4|REBG_LENAE	1.06e-56	2	536	4	421	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
sp|J4VV61|GT1_BEAB2	9.16e-19	1	483	19	427	UDP-glucosyltransferase 1 OS=Beauveria bassiana (strain ARSEF 2860) OX=655819 GN=BBA_08686 PE=2 SV=1
sp|E7CQW6|UGTA1_STABO	1.65e-18	3	481	10	402	UDP-glucosyltransferase A1 OS=Starmerella bombicola OX=75736 GN=ugtA1 PE=1 SV=1
sp|E9L011|UGTB1_STABO	5.77e-17	3	481	8	398	UDP-glucosyltransferase B1 OS=Starmerella bombicola OX=75736 GN=ugtB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000074	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPSK_01110-t39_1-p1.