CAZyme Information: SPSK_00893-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_00893-t39_1-p1
• CAZy Family: AA3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		23886.70	6.9180

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000011:1920791-1921489(+)

Full Sequence      

MIPTQALSALVPAALLLFAQSAGADSTGTTTRYWDCCKPSCAWPGKGSLAQGPVATCDKN
DKPLNDNGATASGCDNGGGAFMCSSQAPWAVNDTVAYGYAAVRISGSTESAWCCACYELT
FTSGPVQGKKLVVQATNTGGDLGANHFDLAIPGGGVGAFNACTQQYGAPPNGWGDRYGGI
HSASDCASFPQALKAGCQWRFDWFKGADNPSVTFKPVTCPAELTAKSGCKRN

Enzyme Prediction     

EC	3.2.1.4:59

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH45	28	230	5.1e-91	0.9949494949494949

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
280233	Glyco_hydro_45	5.45e-78	27	230	1	214	Glycosyl hydrolase family 45.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO65930.1|GH45	2.20e-131	6	231	7	227
APQ40634.1|GH45	3.61e-128	7	231	3	229
QBZ56098.1|GH45	9.94e-128	14	231	10	227
UQC88154.1|GH45	2.03e-126	15	231	14	233
ACH15008.1|GH45|3.2.1.4	2.98e-126	16	231	15	225

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MVI_A	1.02e-98	14	232	13	224	Apo Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A],6MVJ_A Cellobiose complex Cel45A from Neurospora crassa OR74A [Neurospora crassa OR74A]
5GLY_A	1.61e-98	24	232	1	203	Crystal structure of a glycoside hydrolase in complex with cellotetrose from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126],5GM9_A Crystal structure of a glycoside hydrolase in complex with cellobiose [Thermothielavioides terrestris NRRL 8126]
5GLX_A	1.85e-98	24	232	4	206	Crystal structure of a glycoside hydrolase from Thielavia terrestris NRRL 8126 [Thermothielavioides terrestris NRRL 8126]
1HD5_A	6.20e-96	28	232	3	202	Endoglucanase from Humicola insolens AT 1.7A resolution [Humicola insolens]
1L8F_A	2.05e-95	26	232	1	201	Structure of 20K-endoglucanase from Melanocarpus albomyces at 1.8 A [Melanocarpus albomyces]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P43316|GUN5_HUMIN	2.61e-94	28	232	3	202	Endoglucanase-5 OS=Humicola insolens OX=34413 PE=1 SV=1
sp|P45699|GUNK_FUSOX	9.13e-93	24	232	18	222	Putative endoglucanase type K OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|D3GDK4|GUN_CRYAT	1.26e-85	10	231	5	221	Endoglucanase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
sp|O97401|GUN_PHACE	1.80e-56	23	229	35	240	Endoglucanase OS=Phaedon cochleariae OX=80249 PE=2 SV=1
sp|P18126|GUNB_CELJU	1.69e-48	28	232	269	501	Endoglucanase B OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999763	CS pos: 24-25. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in SPSK_00893-t39_1-p1.