CAZyme Information: SPSK_00791-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_00791-t39_1-p1
• CAZy Family: AA2
• CAZyme Description: alpha-1,3-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463		51977.20	7.6555

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000011:1241775-1243206(+)

Full Sequence      

MFRQPWHDRVASRRRLFKVAVAVGLVGLVMLYRSLWYDISSPVPYVPWTRTDYGGTWMNG
AYADVEGVTAAPPARWTLPPNAPGKAKHQRTARVHAQLILEQAEATPDQNHLGCPALNHE
RYAELVPQPSEGDGNSHNSHRTYFFCTRLAPGPVRFLGPANCVVSIVEGHSNDGTYETLL
LLQNALNAMGAVVYIQSTSINPLFGDRIGKLAKLRNLALEPMHLESANMHPDQSVILFLN
DVAACTEDLLELALQRRRQHADMACAMDYHRLDRQYDYKLTFYDVWISRTMDGEAFIMAP
PGLAQWRFADDLFPYDDLARARYAQRRPFQVFSCWNGAVALTARPFFDKKVEFRRAYKNV
GECGAGEPTLLCKDMWSQGYGKIVVVPSVSLGYSVNEGLDVKGSMGYTANWTATEDAGGD
GIEPMAVDWDPRPPTVVRCIPSWRKQFWQAWDFGVGKLRASKA

Enzyme Prediction     

No EC number prediction in SPSK_00791-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	154	376	3.8e-61	0.8870292887029289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	4.87e-70	154	371	26	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC76038.1|GT69	1.42e-108	14	455	9	440
UKZ71718.1|GT69	5.20e-94	112	452	76	413
QLI67260.1|GT69	8.04e-94	112	452	80	416
QYS99732.1|GT69	4.43e-90	98	452	69	416
EAA28991.1|GT69	3.56e-89	107	452	100	451

PDB Hits     

SPSK_00791-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6U1Z4|CMT1_CRYNJ	7.63e-41	154	441	153	443	Alpha-1,3-mannosyltransferase CMT1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999028	0.000990

TMHMM  Annotations     

Start	End
20	37