CAZyme Information: SPSK_00737-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_00737-t39_1-p1
• CAZy Family: AA2
• CAZyme Description: mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
656	AXCR01000011|CGC4	72627.17	7.8301

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000011:1886799-1888769(-)

Full Sequence      

MAILLSAISLRRKTRLLVSVAAAFLLIVYVFQPRAGRVHLHKVLQPARESTDPIFYVNSS
VNWALRQRLHPIPDASLVRLPTGTPAPMPAIQYNFRADPDYKSADVKLLRDTRRDAIRSA
FLRAWESYRQHAWGYDELLPIKLKGKDGFSGWGATLVDALDTLWIMDLRNEFDEAVRAVA
TIDWDAATGFECSLFETNIRYLGGLLSAYEMSGATPLLDKAKELAHMLLAAFDTASHMPA
NRFHFDRAWQGLLVPGDHEASAAVGTLSLEFTKLAQLTGDHRFYDAIDRIKRALAQVQDT
TTIPGLWPTFLDLQNGFKANGQMYTLGGMADSLYEYLPKMHMLLGGQDAAYRDMYVKAAD
AARQHLLFRPMIPDPDVRGHDILVSGTVLAGGPRNGVSLMPEGQHLACFAGGMFALGGKL
FDRPADVEVGTKLTQGCIWAYDAFPTGVMPESFDLVPCPKPSGWLDKMALIATNKAASAA
SAAENTTACPWDEPAWRAAQFPKDKTGRYPPGFAAIRDPRYLLRPEAVESVFLLYRITGD
RSLQEAAWRMYLNIERSTATKHANSAIADVTVTGPPQKLDSMESFWFAETLKYLYLTFTE
PDYFSLDDYVYNTEAHPFKIPKPAAAPLPPITNGRVKAKTHQSTGQKAGKTTKTGG

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	120	620	5.9e-159	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	120	620	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.64e-123	70	620	30	518	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.002	200	295	472	568	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERS95974.1|GH47|3.2.1.113	0.0	1	656	1	656
AEO54071.1|GH47	8.38e-214	5	623	1	599
VBB72615.1|GH47	1.70e-203	56	623	43	611
CDP23506.1|GH47	5.70e-202	56	623	43	612
CAP69486.1|GH47	5.70e-202	56	623	43	612

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FO2_A	6.99e-71	113	624	10	460	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KIJ_A	2.16e-70	113	620	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	2.52e-70	113	620	10	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
5KK7_A	3.26e-70	113	624	5	455	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	4.79e-70	113	624	88	538	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AV26|MNS1B_ARTBC	1.97e-75	116	620	43	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1
sp|Q2ULB2|MNS1B_ASPOR	1.12e-73	111	620	38	508	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1
sp|B8N417|MNS1B_ASPFN	1.12e-73	111	620	38	508	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|E9CXX8|MNS1B_COCPS	2.90e-71	113	620	45	514	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|Q5BF93|MNS1B_EMENI	1.12e-69	111	623	31	504	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mns1B PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999959	0.000042

TMHMM  Annotations     

Start	End
16	33