CAZyme Information: SPSK_00397-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_00397-t39_1-p1
• CAZy Family: AA11
• CAZyme Description: mannosyl-oligosaccharide alpha-1,2-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1043	AXCR01000012|CGC12	114246.00	5.3771

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000012:432956-436191(-)

Full Sequence      

MAFLRFRRYRVYIFAAVFFLFLVFRLSSNSQLNAHHTTIYKGYSAPPDGESSAGRGSSSS
SSHDSASGNFGAGTPAQDAPPSLGSPDVSAPKVPAEKEPEKVAASAPQSMHIPQLHTSLE
IKGSYGLPTGPRSQKPTAPQQTDAAASAPKEDGAFDSNRVHQVDPPATHQETAVPVVADA
TAKARPILSTSVIHWMKMAEHFPIPEESLILLPTGSPMPIPKIQHKFAAEPDATREIRES
RLASVRGEMQHAWSGYRTYAWTHDELAPVSKGFRDPFCGWAASLVDALDTLWIMGMHDEF
DEAYEAVKDIDFTTTPFRSEIPVFETIIRYLGGLIAAYDVSGGEKGKYPALLSKAVELAE
ILMGVFDTPNRMPILYYHWKPAFYSQPKTASSSVSVAELGSMSMEFTRLAQLTGHSKYYD
AIARITDAFEDWQNRVNGTAIAGIFPEHVDASGCNRTAAAIQEAENASKLAKAQVAAAND
IETEPVGYKPSQPNSDPMVAQDKVAIAKTMPPDLEFRVNSATKPGEPATGEFRKVDDVAS
ASVGKRDVGDAVSKGAAPNDATARVAVAPDEGKTPPGSKIMAGSDVQHANKPVSAPIAAN
GKVAKFDCIPQNLTAGGYGMQTYSMGGSQDSTYEYFPKQYILLGGLVPKYQAMHEKVVDA
VKKYLLYRPLIKDDRDILFSAKVSSRDGTDKDMTYNYEITHLTCFLGGMFAMGGRIFNRP
EDVKIGGKLADGCAWAYEAMPMGIMPEGSIITPCANMTNCSWNQSTWYEKLDPNIAWRTK
QMLDYEERMKTWAKESDEIKELQRARAEELERERQATLEEALANEPSSPADAVGLAPGPE
TPVGTANIGKRAVGGADKTPVTAADAVAINEKEKVLQGDLDLNADAAAVPKAAAPAKKPL
PELVIPPMPVRPETHEEFVQNRIERDNLVPGFISMNDRRYILRPEAIESVWYMYRITGDS
SWQEKGWRMFQAVIHATRTEYGHSAIADVLRDPKDEPVQVDNMESFWFAETLKYFYLLFT
TPDVISLDDYVLNTEAHPFKRPT

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	249	1041	7.1e-173	0.9955156950672646

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	3.65e-171	248	1041	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.54e-74	200	1042	28	519	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.004	329	429	472	567	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ERT02678.1|GH47|3.2.1.113	0.0	1	1043	1	1043
AEO67971.1|GH47	2.71e-298	109	1043	105	882
AEO60003.1|GH47	3.54e-284	110	1043	88	898
UQC81050.1|GH47	9.69e-274	189	1042	174	1026
QBZ62321.1|GH47	1.18e-260	4	1042	2	1024

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2.57e-30	239	1038	3	470	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	2.99e-30	196	1038	1	505	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	4.53e-30	251	438	15	193	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	4.73e-30	251	438	15	193	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	4.93e-30	251	438	20	198	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60476|MA1A2_HUMAN	9.29e-34	217	1038	158	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.65e-33	217	1038	158	623	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|Q12205|MNL2_YEAST	5.93e-32	260	1041	175	848	Putative endoplasmic reticulum mannosidase MNL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL2 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	9.63e-30	251	438	217	395	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2
sp|P31723|MAN12_PENCI	1.54e-29	196	1038	1	505	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000000

TMHMM  Annotations     

Start	End
9	26