CAZyme Information: SPSK_00162-t39_1-p1

Basic Information

• Species: Sporothrix schenckii
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Sporothrix; Sporothrix schenckii
• CAZyme ID: SPSK_00162-t39_1-p1
• CAZy Family: AA1
• CAZyme Description: fungal cellulose binding protein domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288	AXCR01000009|CGC2	31034.06	7.9813

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Sschenckii1099-18	10434	1397361	141	10293

• Gene Location: location=AXCR01000009:17439-18305(+)

Full Sequence      

MQVQIRFIGAVVLLGLSLLGAALADKSAGCGKDPTMTNKQYTMTVNGKQREYIMKLPDHY
DKNRPYRLIFTWHPRGGSATKIVQGEDIHHGGALPYYGLPPLANNSAIFVVPNGLNNGWA
NSGGEDLTFFDQMVKAVEADLCVDTTLRFSTGFSYGAAMSYAIACARPQVVRAVAILSGA
QLSGCSGGTDPVPYYGQHGTSDSVLQTSMGRSLRDHFVKNNGCTPVSPEPMPNNGKSVKT
VYQGCKQGYPVTWVIHKGDHNPSETDPGSSTPFAPGNTWEFFSQFTSV

Enzyme Prediction     

No EC number prediction in SPSK_00162-t39_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	46	184	9.6e-19	0.6035242290748899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	3.70e-15	38	284	35	306	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	1.79e-04	44	179	372	506	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
223489	DLH	0.002	136	203	102	170	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP24862.1|CBM1|CE0	1.18e-130	11	285	6	278
CAP67448.1|CBM1|CE0	1.18e-130	11	285	6	278
VBB74107.1|CBM1|CE0	1.67e-130	11	285	6	278
QLK00730.1|CBM2|CE0	4.18e-103	20	288	32	302
QLQ34929.1|CBM2|CE0	2.68e-102	27	288	58	315

PDB Hits     

SPSK_00162-t39_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7RWX8|FAED_NEUCR	7.49e-124	12	285	12	289	Feruloyl esterase D OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=faeD-3.544 PE=1 SV=1
sp|Q0CDX2|FAEC_ASPTN	3.66e-80	12	282	11	267	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|Q5B2G3|FAEC_EMENI	5.93e-79	10	282	4	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|A1DI08|FAEC_NEOFI	3.60e-78	10	282	9	269	Probable feruloyl esterase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	4.78e-78	13	282	10	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000435	0.999537	CS pos: 24-25. Pr: 0.9778

TMHMM  Annotations     

Start	End
7	24