CAZyme Information: SPRG_22268-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_22268-t26_1-p1
• CAZy Family: PL7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		41143.11	7.3718

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583264:132182-134084(+)

Full Sequence      

MKIFALASVLAPVYAKITSSALRAIEQDATFTAFVTFKGSPAAETESAAVTGRKQTLSEI
VGDRKVKAFWITNAATVENVDRALADKIAKLDNVLKVDVVKTIKLSPVLKKDSTENSPID
NSRPTGIQWGVKTIGATDVWKTTKGEGIVVGSIDTGKKNLNEKFWYNFDDKSIQSQTKNT
TCLDVYQDVQGKNQVRLYTCTGGSAQKWDFEPNSHSLRHLAVRNLCLESAHATPGAAPFV
ADCTGGVSQWFTKCEEAPAAKSYAISEFYSGVYANWASDTANELFTYDSAAKTLQAASNG
QCLDAYRDGNKFGLHTYACDATNGNQKWIIDAGNHKIKHATHNNLCLDVDPTNPAHAAQV
WECHNANTNQWIDAVKY

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	9.70e-17	182	328	13	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	1.53e-16	224	371	11	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.29e-13	217	372	3	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	2.91e-11	138	252	14	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	6.16e-11	159	250	34	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56171.1|CBM13	7.55e-157	6	377	7	751
AIG56439.1|CBM13	5.81e-132	153	377	515	748
AIG56438.1|CBM13	5.08e-83	96	377	459	748
AIG56170.1|CBM13	9.91e-82	153	377	513	745
AIG56036.1|CBM13|GH17	7.46e-53	153	377	464	691

PDB Hits     

SPRG_22268-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_22268-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.890966	0.109046

TMHMM  Annotations     

There is no transmembrane helices in SPRG_22268-t26_1-p1.