CAZyme Information: SPRG_22219-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_22219-t26_1-p1
• CAZy Family: GT61
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748		80281.78	8.1033

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583224:197844-201385(+)

Full Sequence      

MQATSAWSGHAVVAALAAATFANTLTCGFVWDDRAAILTNRDLRTDETSMWDLWSHDFGA
GHSLLTFRANYAVGGYNPMGYHLLNVLLHVAASVLVVAVGRRVVAPFGASHAPVFAGALF
AVHPIHCDAVASVVGRADVLCTCLSLLAFCLYDASASATCTHWPLYVASLVCILAATLCK
ELGAATLGILVTLELLRAAPSKSKRLGPSAGVVRTAVLFGLGSAGIASRIALNGGQTLYA
WSILENDVSLLPWGVPRLLTTLHTHGWYLYKLFWPQYLCNDYGFRTIPIIASLFQMENVG
TLVAYASLLVLVGVAFDRRRTSPLLLLASFGLFPFVPAANVLFPIGTVVAERLMYFPSVG
FCFVLGYALEHALRVSMRWQSLLLALLFLSLLTVGAARSMARNFEWSSETRLFESSVLTA
PWSVKGLSNLSKVLLGPDPPRAAAYLERALSVAPRYAAGQLNLGLAYIRMGKPLHAMQNL
LHSIDVDASLAAYAYLGRCASSFYLASQLKQFPTSNATHACQLAHQLLDYTIAQGASMPG
LFFARGLLAYYTSDFSTAFAVCANQLTTPMNQQQPTTTAYEIQPTPTVKPVAPDGMEADA
NNLVVGQWKVGICGCFTDVIPNCCMAYWCPCVSLAQIVHRIGTCSYMMGLLVFGLAYLLM
YITAAVSGGYHYSAIASGSAGVACGICVMIVRNIVRGKLRIPGNCLIDCLCGFFCNCCAI
AQMATQVNAYDKGTCAFGPKDTLPGYMA

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	70	199	6e-33	0.9236641221374046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398426	PLAC8	1.78e-20	608	724	1	98	PLAC8 family. This family includes the Placenta-specific gene 8 protein.
273697	A_thal_Cys_rich	6.80e-12	606	728	1	103	uncharacterized Cys-rich domain. This model describes an uncharacterized domain of about 100 residues. It is common in plants but found also in Homo sapiens, Dictyostelium, and Leishmania; at least 12 distinct members are found in Arabidopsis. Most members of this family contain more than 10 per cent Cys, but no Cys residue is invariant across the family.
276809	TPR	9.31e-06	438	499	16	78	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.54e-04	411	485	22	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	5.95e-04	396	495	777	875	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD7262601.1|GT105	1.32e-50	19	467	17	490
Q5T4D3|GT105|2.4.1.109	6.85e-43	12	443	25	501
BAF83034.1|GT105|2.4.1.109	9.22e-43	12	443	25	501
AAI66274.1|GT105	2.96e-42	12	456	24	511
BAC25886.1|GT105	8.79e-42	21	443	33	501

PDB Hits     

SPRG_22219-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5T4D3|TMTC4_HUMAN	1.22e-43	12	443	25	501	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	5.77e-42	21	443	33	501	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q6ZXV5|TMTC3_HUMAN	7.33e-42	12	479	11	502	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	1.32e-41	12	476	16	504	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	5.69e-41	23	478	50	569	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.776122	0.223876

TMHMM  Annotations     

Start	End
7	29
78	100
210	232
294	316
323	345
375	397
642	664
669	691