CAZyme Information: SPRG_21526-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_21526-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848		94748.31	7.1422

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583363:13853-17504(+)

Full Sequence      

MRWHVAVGVGGLLVISLLSCQRLDSLLYTIQDKAVHHASAAAHYARYQLYPSLEQVLPYA
GSFLFPTVVARHGASYSCIKFQYTGTGGCPSQINDIVSYVYTPNKTEACDTVIHTGIYGV
PGYCELRDDVTHETIRTLYTSCGSLTGRQFTCALAAQYASYGHDASTFIYALNTSFLAPR
GIVFSVHPSALASAYASIAHLRATNCSLPIEVWHRPDELPAENAILQALETTFRVHVRPI
FHPLATRFYSKIYAVLHSAFESVLLLDCDNFAVQNPTYLFSTHAFQSTGAVFWPDYWRPG
HTCFNIDGYSRLWDLLGINFVDMFEQESGQVLINKTMSEPALHVLAFFALHEPRFLTDFG
MVYGDKDLFRLAWLKAAVPFHMIARPPGSLGKLDRADQTHFCGNSMVQHDTNGDVVFLHR
NTIKLTGCRADAFVWEALQDFRFGEVHVARYLPAGYVLRDATCFGVREPSDDLYAMTTIR
QSQFAHLEGALYRYAREAMKLQHPNGSVDGPLLVLVHHASWLHAAGADEYARDYEGNTPL
HHACHAGHARIVQYLLSLPEFSPYVLNAKGDAPLEVARRTFLEREGDNDDLRLVALARCI
ELLEQRCSVYSGWVFQRVHTLFSQLTGITALQTWTRRYCIVLRTSSSMFLEVALFAVPDA
ARRPPVPSTSLLVHVTADEPCIRPTNPSFWSDLNPKPFGFELRGAPKVGSSRTQALRHFS
FAALSEDGAAKWLRFFAHDARECLHDALVSPTRQFNSHELGRAKVYPEPSAPPLPTVETA
QPVVFTKATLRPRLLECVVCFDGPQAAVCVPCGHNVLCMTCAMSLLETTHVCPVCRLEIR
EVVKVYRN

Enzyme Prediction     

No EC number prediction in SPRG_21526-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	180	410	8.2e-50	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	5.49e-40	180	410	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
404755	zf-C3HC4_3	3.93e-14	795	842	3	50	Zinc finger, C3HC4 type (RING finger).
319432	RING-HC_MEX3	1.80e-10	797	836	1	41	RING finger, HC subclass, found in RNA-binding proteins of the evolutionarily-conserved MEX-3 family. The family includes MEX-3 family phosphoproteins have been found in vertebrates. They are mediators of post-transcriptional regulation in different organisms, and have been implicated in many core biological processes, including embryonic development, epithelial homeostasis, immune responses, metabolism, and cancer. They contain two K homology (KH) domains that provide RNA-binding capacity, and a C-terminal C3HC4-type RING-HC finger. They shuttle between the nucleus and the cytoplasm via the CRM1-dependent export pathway. The RNA-binding protein MEX-3 from nematode Caenorhabditis elegans is the founding member of the MEX-3 family. Due to the lack of RING-HC finger, it is not included here.
319634	RING-HC_MEX3A	1.13e-08	796	835	2	42	RING finger, HC subclass, found in RNA-binding protein MEX3A. MEX3A, also known as RING finger and KH domain-containing protein 4 (RKHD4), is a RNA-binding phosphoprotein that localizes in P-bodies and stress granules, which are two structures involved in the storage and turnover of mRNAs. It has been implicated in the regulation of tumorigenesis. It controls the polarity and stemness of intestinal epithelial cells through the post-transcriptional regulation of the homeobox transcription factor CDX2, which plays a crucial role in intestinal cell fate specification, both during normal development and in tumorigenic processes involving intestinal reprogramming. Moreover, it exhibits a transforming activity when overexpressed in gastric epithelial cells. MEX3A contains two K homology (KH) domains that provide RNA-binding capacity, and a C-terminal C3HC4-type RING-HC finger. Like other MEX-3 family proteins, MEX3A shuttles between the nucleus and the cytoplasm via the CRM1-dependent export pathway.
319635	RING-HC_MEX3B	1.17e-08	796	836	2	43	RING finger, HC subclass, found in RNA-binding protein MEX3B. MEX3B, also known as RING finger and KH domain-containing protein 3 (RKHD3), or RING finger protein 195 (RNF195), is a RNA-binding phosphoprotein that localizes in P-bodies and stress granules, which are two structures involved in the storage and turnover of mRNAs. It regulates the spatial organization of the Rap1 pathway that orchestrates Sertoli cell functions. It has a 3' long conserved untranslated region (3'LCU)-mediated fine-tuning system for mRNA regulation in early vertebrate development such as anteroposterior (AP) patterning and signal transduction. MEX3B contains two K homology (KH) domains that provide RNA-binding capacity, and a C-terminal C3HC4-type RING-HC finger. Like other MEX-3 family proteins, MEX3B shuttles between the nucleus and the cytoplasm via the CRM1-dependent export pathway.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29182.1|GT71	5.80e-83	119	503	94	491
CCA25989.1|GT71	4.16e-82	107	508	119	545
UIZ24059.1|GT71	1.17e-81	74	495	139	592
UIZ28362.1|GT71	4.83e-80	95	501	684	1104
CCA20955.1|GT71	5.49e-80	119	441	158	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZI6_A	1.25e-08	796	846	3	54	The RING domain structure of MEX-3C [Homo sapiens],5ZI6_B The RING domain structure of MEX-3C [Homo sapiens],5ZI6_C The RING domain structure of MEX-3C [Homo sapiens],5ZI6_D The RING domain structure of MEX-3C [Homo sapiens],5ZI6_E The RING domain structure of MEX-3C [Homo sapiens],5ZI6_F The RING domain structure of MEX-3C [Homo sapiens],5ZI6_G The RING domain structure of MEX-3C [Homo sapiens],5ZI6_H The RING domain structure of MEX-3C [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4FE47|XB35_ARATH	1.49e-11	525	847	65	461	Putative E3 ubiquitin-protein ligase XBAT35 OS=Arabidopsis thaliana OX=3702 GN=XBAT35 PE=2 SV=1
sp|Q59KJ7|MNN21_CANAL	1.70e-11	180	418	246	534	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|A6ZQE9|MNN5_YEAS7	3.20e-10	194	414	164	437	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	4.22e-10	194	414	164	437	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|Q9FPH0|XB34_ARATH	9.40e-10	525	846	67	374	Putative E3 ubiquitin-protein ligase XBAT34 OS=Arabidopsis thaliana OX=3702 GN=XBAT34 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000127	0.999909	CS pos: 19-20. Pr: 0.9677

TMHMM  Annotations     

There is no transmembrane helices in SPRG_21526-t26_1-p1.