CAZyme Information: SPRG_21347-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_21347-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
272		28479.88	5.8011

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583295:101867-103386(+)

Full Sequence      

MALAASAVSAGLCTAVPPVSYAEAAQKPYLKPVVDVLREYATATWYTDRGGDAISELLSK
CAGATPVIVIYGLPGKDCAGHYSSNGGNQSPADYARWIDSLVSRVGNTNVIYILEPDAIG
NLANNECATQRGYLPNLKVALTKLSSNANAQIYADVAGWANQGAAQEVLSKLKSAGRLNG
IAINTSNYKDTDTLKSICQAYSSATGGLHCVFDTSRNYRGSPQSEWCNAKSGGIGAPPGT
PTGSSIDDDMIERDSRGIVVLVGTSRYSEAVL

Enzyme Prediction     

No EC number prediction in SPRG_21347-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	23	245	3.3e-47	0.8809523809523809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.66e-33	30	248	4	272	Glycosyl hydrolases family 6.
227616	CelA1	2.51e-13	59	247	179	373	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55493.1|GH6	4.39e-95	1	248	7	255
AIG55492.1|GH6	2.60e-91	5	248	14	255
AIG55789.1|CBM1|GH6	6.46e-90	9	252	15	252
AIG55792.1|GH6	2.06e-89	2	248	8	255
AIG55776.1|CBM1|GH6	3.98e-89	1	248	10	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP2_A	7.51e-25	59	248	64	255	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.04e-24	59	248	64	255	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	1.04e-24	59	248	64	255	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.48e-24	59	248	85	276	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	4.71e-24	32	251	27	256	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	1.45e-24	62	247	232	411	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26222|GUN2_THEFU	1.56e-22	32	251	58	287	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	3.91e-21	32	244	61	276	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	1.41e-18	54	245	129	316	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P49075|GUX3_AGABI	1.49e-12	68	251	160	384	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.097919	0.902070	CS pos: 22-23. Pr: 0.8261

TMHMM  Annotations     

There is no transmembrane helices in SPRG_21347-t26_1-p1.