CAZyme Information: SPRG_20971-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20971-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
761		84927.69	6.2911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583251:14592-17138(+)

Full Sequence      

MPHRATALSLLAAAVVVLGADQNDPTLPVKSGVGIWIDVDTPADQYQITSSRGETWDLVM
SDEFNIEGRNFTAGEDHLWTALDIPDGVNRAIGIYTPENAITQNGSFHIRVDSREIDVSF
YNVWSEAPAWASKKMWYASAMMQTWNKFCVQGGFVEISAKMPGATNKESLNSHVTGKRWD
GTKDIPVKPMDRIPEIRFYPTWPGLWMMGNLGRALFAASTNRVWPWTYNECDERYRTSQR
ISACDPNPGYGMHPYMGRGSPEIDILEGGGSDISSSIQIAPGMPDEYRLKFPDMQYERTN
YTDPQGRKGQGHLFCYYEKTCTTPGANMADVPTSAFASRGHKSWYQGLRYAANERCTPVQ
ALKQQYEPVAKAQNGPIIDNQWDVKTISSGRDLHADLGLIDGKGPLHWGINYNGTCFPIA
NGYKGGFLCDRDSQFSKCENPRKDWQVPTKMMEPFEYQMDAISSNWQISFEAYTTYYKYQ
LEWVIGDEGYVRWNLAGAPIFEIPSASLTNPPQGPPGKEKNPPKIMIEEPSYFIFNVAMA
SAWGATPPNWEIGGCRGNATHPKPGSWEHKVTNNICDSFPMFLSVDYIRVWQDTKTMSVG
CDPASHPSKEFIKAHITNYTDPKNPYIIVAGGATCNTDDDCTPAASITGSCVNRRCKCMG
VWTGPRCTKYDLEESTYGPPMYAMVGIFGVAFLGLGFSTLVRSRRHAILRLQHEHELRAE
KERSHSAASNDPLPPQAMASEVSIIMGDPPKAAHDHRPSPY

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	62	306	1.9e-67	0.656441717791411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	9.51e-57	37	622	98	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	5.76e-44	58	592	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	1.97e-05	37	282	30	215	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185693	GH16_laminarinase_like	3.34e-05	61	272	2	125	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	7.95e-05	461	591	145	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55703.1|GH16_2	0.0	6	679	6	698
UIZ28151.1|GH16	2.21e-216	1	701	8	698
UIZ28152.1|GH16	7.64e-216	15	703	6	688
UIZ28149.1|GH16	5.88e-211	6	690	8	691
UIZ27810.1|GH16	5.42e-207	28	690	66	722

PDB Hits     

SPRG_20971-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	1.22e-34	37	624	307	705	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	1.77e-34	37	619	336	714	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P33336|SKN1_YEAST	1.50e-33	37	281	359	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87023|KRE6_CANAX	1.30e-32	37	619	332	717	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	2.27e-31	37	268	219	415	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000331	0.999637	CS pos: 19-20. Pr: 0.9758

TMHMM  Annotations     

Start	End
679	701