CAZyme Information: SPRG_20753-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20753-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		71314.94	6.7859

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583232:3278-5220(+)

Full Sequence      

MWAWDWTQWETHVDWMVLNGINMPLAITGQEKTWQETFKLFHVSSQGLDRFLGGAAYLAW
ERMGNIRGDWSPLGRLPQHFIDAQHALQLKLLSRYREFGMLPALPAFAGHVPDEMRTLYP
SASMRQSDQWAGFDRNYTCVYMLDPTDPLYRAVGKAFLTTQQTLYGGYTSSLYSADTYNE
LLPHTSDHAYLRASSNAVIESMLAVDPNAVWLMQAWLFISKRDYWTQDKVQAYLAGVPNH
RMLVLDLNSSVLCATKNYYGKDWVFCVLHTFGGNLGLHGNLPHLASAPIAAKAQSNGTMV
GLGLTMEGIFQNYVVYDLSLDMNWQSTPLNVSSYVTRYVRSRYHVASPHAQAAWTSLTAA
VYSGRDKHNNLMTFRPRFNMLAYRPVLRHLKVRGEPVRDAWRQLLDAATAKPGLATTDAF
THDLVDVARQGLSDLMSTYYETFLDLYHAPTTTTVPVLRAQANAILTLMWDCDRVLATHP
DFLLGRWIADAKRLQASGDAAYFEFEARVQITTWSLNDILNDYARKEWAGVVGDYYLGRW
HLWLQAVVAAFAAKRPVDDAAINDLLRAFEHKWLYDTKVYPTHGVDDPVAVAAELWTKYY
AGALATTKTTETVWSDDSVTSSWPARTDM

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	4	597	1.8e-180	0.8853695324283559

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	4.25e-151	1	326	13	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	4.11e-70	334	592	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56322.1|GH89	9.29e-316	1	599	143	747
AIG55749.1|GH89	3.06e-307	1	623	141	768
AIG56008.1|GH89	1.40e-217	2	601	139	740
AIG55486.1|GH89	9.14e-205	2	601	136	731
AIG56414.1|GH89	2.45e-187	2	596	145	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	3.07e-131	4	600	122	712	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.77e-64	4	601	285	878	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.92e-64	4	601	293	886	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	1.47e-63	4	601	308	901	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	2.97e-130	4	600	145	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	8.48e-121	4	600	172	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_20753-t26_1-p1.