CAZyme Information: SPRG_20681-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20681-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
739	KK583231|CGC1	83450.68	6.5632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583231:243650-245961(-)

Full Sequence      

MQSLVARRLGLPYVSQLAFEVVPLGDNGLDVATIDMQDGRIHISGSSATAMGYALHSYLK
DVVHTQVNWDNHALRLPPVLPPVPSRTTLAKASKVTYYLNICTHSYSMWAWDWTQWETHV
DWMVLNGINMPLAITGQEKTWQETFKHFNVSSQGLDRFLGGAAYLAWERMGNIRGDWSPL
GRLPQHFIDAQHALQLKLLSRYREFGMLPALPAFAGHVPDEMRTLYPSASMRQSDQWAGF
DRNYTCVYMLDPTDPLYRAVGKAFLTTQQTLYGGYTSSLYSADTYNELLPHTSDHAYLRA
SSNAVIESMLAVDPNAVWLMQAWLFISMRDYWTQDKVQAYLDGVPNHRMLVLDLYSEEAP
FYAPTKNYYGKDWVFCVLHTFGGNLGLHGNLPHLASAPIAAKAQSHGTMVGLGLTMEGIF
QNYVVYDLSLDMNWQSTPLNVSSYVARYVRSRYHVASPHAQAAWTSLTAAVYSGRDKHNN
LMTFRPRFNMLAYRPVLHHLKVRGEPVRDAWRQLLDAATATPGLATTDAFTHDLVDVARQ
GLSDLMSTYYETFLDLYHAPTTTTVPVLRAQANAILTLMWDCDRVLATHPDFLLGRWIAD
AKRLQASGDAAYFEFEARVQITTWSLNDILNDYARKEWAGVVGDYYLGRWHLWLQAVVAA
FAAKRPVDDAAINDLLRAFEHKWLYDTKVYPTHGVDDPVAVAAELWTKYYAGALATTKTT
ETVWSDDSVTSSWPALTDM

Enzyme Prediction     

EC	3.2.1.50:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	38	707	2.8e-207	0.995475113122172

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398659	NAGLU	1.54e-167	97	436	2	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
404009	NAGLU_C	2.68e-70	444	702	1	257	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
404008	NAGLU_N	5.78e-14	1	75	3	75	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56322.1|GH89	0.0	1	709	36	747
AIG55749.1|GH89	0.0	1	733	34	768
AIG56008.1|GH89	2.44e-268	3	711	33	740
AIG55486.1|GH89	1.36e-254	2	711	29	731
AIG56414.1|GH89	1.93e-230	2	706	38	745

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	1.16e-154	2	710	10	712	Crystal structure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	2.06e-81	2	711	175	878	Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.33e-81	2	711	183	886	Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.04e-80	2	711	198	901	CpGH89 (E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54802|ANAG_HUMAN	1.18e-153	2	710	33	735	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
sp|Q9FNA3|NAGLU_ARATH	9.43e-135	40	710	94	805	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_20681-t26_1-p1.