CAZyme Information: SPRG_20663-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20663-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
584		66668.92	6.2052

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583231:130475-132277(+)

Full Sequence      

MDATHHLTYRVDDVEYVAVYDTTVQHIPLRKDLSHLRPPPPRLTDKRDIFIGVTAYRDGV
KCGFTLWTAFSRAAHPERVFFGVVDQTLDGDVACFNAYCERARETWPDEPCKYQSQIKID
ARSATTSKGPVVSRAQLYPLLGDQGFSMMIDSHVQFAQKWDDLIIAEWAATENEMAVLSN
YPINYDHLDADATFTGNYAPHVCNFMPRPAASSVIYYSGILVAYNFEHPLLSVSWAGGFS
FGKSHSWHRAPMDPYMNWVFWGEEFLHAYQLWTRGYDMYSPSRHGNVVFHNWTDNGDKHR
FTDNVTRVTTQAEHDREEAMAYNRFHLIFQQPFSGEVDSREIDKYGSGSVRSREQFMKFS
NISMTNARKDFAACNQLHFVPYTDPTELEALLPGWRFADSTGLLRTDAVTVNNSVLHDLR
GKLDDAETTVTQLRHAVEAARLEQTTGFQLLETARKELEEKEQATLREMQLTVTQLRHAV
EAARLEQTTGFQLLETARKELEEKEQATLREVQLTLEKVAQHNSRAISGVSLRLRQIQET
STQVYTELALVVLVLVTVLTALFGRCWGKRGSKSVSYTKLESTD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	48	364	1.2e-59	0.9939393939393939

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	1.88e-40	48	363	1	348	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.
274008	SMC_prok_B	3.12e-04	419	522	857	959	chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]
226809	COG4372	8.61e-04	416	539	76	200	Uncharacterized conserved protein, contains DUF3084 domain [Function unknown].
215212	PLN02372	0.002	450	530	362	455	violaxanthin de-epoxidase
234714	xseA	0.008	419	528	280	386	exodeoxyribonuclease VII large subunit; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22573.1|GT60	9.94e-97	13	408	36	443
QVE55543.1|GT60	9.52e-93	21	400	41	416
UIZ25301.1|GT60	3.73e-90	21	394	22	393
UIZ25379.1|GT60	3.84e-85	18	396	41	418
CCA18910.1|GT60	9.01e-37	47	383	85	413

PDB Hits     

SPRG_20663-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	2.90e-20	45	292	2	249	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000000

TMHMM  Annotations     

Start	End
542	564