CAZyme Information: SPRG_20545-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20545-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
773		81615.55	7.7320

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583222:309202-312152(+)

Full Sequence      

MTHLQPRKDHLIGRPLVPFFTEEGHVNASLQLSSAATHEAMDVDARVWNAEQGYFEYPEP
ACTETSKRTLLLTPQRLEEEHSRSRGKTHPTPSTEKPRSPPRAGSNSKKQRSKKPTAAVE
PHMPPKPTQPKQRSPSSTTSNSTTSNTSTGQKKKTTQAPAKWAWSAFQSSPDPKTLPMPP
FLSPQPVVTEKPSPPPPPAPSIQILQRPKTTATKPEDAMTQQLRKMLNMEPTSSPRLAAS
YTLPHTATSLYPSFFNLIYENATFLTTSVALAAVASATTICSAVPPFNYLSASTAHPQLA
PALDVLKQQPIATWYTDQYASDISGLMAKCQGATPAIVVYGLPQKDCAHGYSSAGGNANT
ADYAKWIQGLMNQVGSNRDVIYILEPDALGLLANHPCATQHNYKANLRIAIEMLASNPKA
KIYADVAAWGDVPKTTALLNELKAAGRLSGIAINTSNYVSNDKLVSTCETYSAATQGLHC
IFDTSRNFNGSPSSEWCNAKSAGVGAPPTADTGYPLVDYFLWLKVPGESDGQCNDAGRTS
DAAAGPGAGQFFPDGLERLWNQGHFVQKQGMPKIGGVWPQSTTASPTPLVTPAPTPLVTP
AVTHAPTAAVTNAPTAAVTTAPASPTTTPTVTTTTPSATTASPTTGPTTTAPATHTTETP
VSTSYDVPLVDHSTAGSVAHGGDILDTPTPPTYDSKPSTSQTYTASTGTHDNGTDSTTIA
LSSLVGVGAVAAVAVAAIALRKRITEDKAALELERDASGIVILTTDRAQTSIL

Enzyme Prediction     

No EC number prediction in SPRG_20545-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	292	534	4.3e-56	0.9421768707482994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	7.23e-43	297	537	2	291	Glycosyl hydrolases family 6.
227616	CelA1	2.80e-22	328	603	179	469	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55776.1|CBM1|GH6	4.12e-115	268	591	5	320
AIG55493.1|GH6	9.29e-112	280	575	21	309
AIG55792.1|GH6	2.49e-108	268	588	4	320
AIG55947.1|GH6	5.79e-108	284	566	22	301
AIG55492.1|GH6	6.54e-108	265	575	7	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	5.39e-33	328	533	64	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	5.39e-33	328	533	64	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	8.66e-33	328	533	85	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	1.35e-32	328	533	64	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	2.40e-31	304	544	31	279	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	2.18e-29	304	544	62	310	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	3.60e-29	288	531	49	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	4.29e-27	309	544	110	353	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P07984|GUNA_CELFI	3.90e-26	328	554	229	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P33682|GUN1_STRHA	4.80e-19	310	554	69	312	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000001

TMHMM  Annotations     

Start	End
718	740