CAZyme Information: SPRG_20318-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20318-t26_1-p1
• CAZy Family: GT59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
143		15981.13	6.0648

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583216:409390-409970(+)

Full Sequence      

MMHNIAAVFLLMASMVDAKGLDTVLSKATFQKLFPNALPIYQYENMIAMSQKYPAFANTG
NNDVDKREVAAFLGQISLESGDLQYVEEINKNEYCQASDKYPCAPGKQYFGHFSGSTQCL
DGDKCHKYDAWYSQCIPAKPHTS

Enzyme Prediction     

No EC number prediction in SPRG_20318-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	19	112	7.4e-24	0.46320346320346323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	4.48e-26	25	111	1	105	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	5.11e-15	41	111	25	109	Chitinase class I.
197593	fCBD	1.59e-04	113	136	11	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55513.1|CBM1|GH19	6.62e-52	1	111	1	111
ETV63620.1|AA15|GH19	8.36e-38	20	111	335	426
ETV82190.1|AA15|GH19	5.95e-34	20	111	399	490
AIG56150.1|GH19	5.49e-32	2	111	1	97
BBN09525.1|CBM18|GH19	9.24e-26	20	111	128	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IJ4_A	4.93e-22	28	111	10	95	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	5.03e-22	28	111	11	96	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
1WVU_A	3.37e-17	24	111	63	154	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	9.10e-17	24	111	63	154	Chain A, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
2CJL_A	1.04e-15	24	111	2	93	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q41596|CHI1_THECC	3.12e-16	17	111	68	183	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P06215|CHIT_PHAVU	4.34e-15	21	111	76	186	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P36361|CHI5_PHAVU	5.95e-15	21	111	75	185	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|P85084|CHIT_CARPA	3.62e-14	20	111	1	113	Endochitinase OS=Carica papaya OX=3649 PE=1 SV=1
sp|Q39785|CHI2_GOSHI	1.25e-13	20	111	51	164	Endochitinase 2 (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000234	0.999736	CS pos: 18-19. Pr: 0.9802

TMHMM  Annotations     

There is no transmembrane helices in SPRG_20318-t26_1-p1.