CAZyme Information: SPRG_20067-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_20067-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		66494.83	6.5407

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583208:60046-62005(-)

Full Sequence      

MDGGPYVNVTHPLQAPRSHLHPSIAGSPFPTGAFWTNFVLGNEAVASLPYSVKVIDQQLQ
ISYPFRVVTAANIIEGFTAELVVDVGASPLVVVRYDALSVTLSFQDGGILLHLVRGSPYI
TLEYKGATPLLSSALEMLSLKDDPAHNCSELLLGNWHKWLLFASSPMQWTRDGKTFRGPS
SYNGVLRLGLELYSGARPLLAQHASTYPVGAAISHHVDAKNASIMHWRFDWTTASFPGRS
APPLLMTCLLHHMDTFTANMTLLDEVKYMAIRGPMTGVVGNTWRFLDVIEDPAWDYPSQG
IMASPGSPAYVAAVAAIKAALQSDIALYPTFTLDAYNFGKQIAREARLVLMAERFNDSST
VAIGLAKMKRELAKWWDPASTNCFYYDTTYGGLVTKAGLADRDAEFGAGYYNDHHFHYGY
FAYAAAVLRRFDPTWVAANAAAIDMIVGDIAADENSLLFPAARHKDWFTGHSYASGLFSM
SNGKSQESSSEAVNAYYGVALYASLDATETPGFYNYAKLLLAMDVRSTQRYWHMSERQTP
AIYEPVFAANRMVGVVSEMSVVYSTWFGNLASEIHGINLMPITPMTSHLVRYLCVYHAIV
LIIN

Enzyme Prediction     

No EC number prediction in SPRG_20067-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	15	591	2.1e-133	0.882636655948553

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	9.80e-76	321	591	18	285	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	3.60e-66	90	589	171	684	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	4.93e-37	11	283	1	303	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	7.53e-134	11	591	57	717
CCA18874.1|GH81	4.13e-128	5	597	9	678
UQA58532.1|CBM6|GH81	7.37e-92	8	591	283	856
AKT41788.1|CBM6|GH81	1.79e-90	5	591	274	849
CAN97272.1|GH81	4.75e-86	6	590	76	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	5.41e-47	113	591	157	653	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	6.44e-47	113	591	182	678	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.15e-45	113	591	157	653	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.13e-32	97	589	111	588	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	8.00e-24	116	581	153	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UT45|ENG1_SCHPO	1.70e-41	101	587	175	664	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	2.13e-40	94	589	123	631	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.68e-38	113	588	342	826	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	3.00e-36	26	587	458	1068	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	5.40e-30	333	589	780	1040	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000005

TMHMM  Annotations     

There is no transmembrane helices in SPRG_20067-t26_1-p1.