CAZyme Information: SPRG_19383-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_19383-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	KK583193|CGC1	75853.25	8.5504

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583193:325383-327737(-)

Full Sequence      

MTTLPERLLARVTSSMSALGGTAKLVTAQEGFRLIEQGVLAERQQHYKEAVDRFLGAAGV
LDAVAATEADLHVRRLLHAKASDVVAWTEGIVAWMQHRPEVRPAYPPRQSKGISMPTTTV
SAATLAFGMDEVERTSLHYTPVLTRSPSEFSRDGYELQVLRRHRRPRMLIVITMYNEDGS
EIEATLRKVGNNVAYLCRHDLPGYEGELAWQNVLVVIVSDGRAKASASTLITLREMGVYD
EDTLRITSAGLATSMHLFERTLLLPEAPGAKKLWTHTSETMPPLQVVFALKEENAGKLHS
HLWFFHGFCNQVDPTYTVLLDVGTLPTKSALYKLVSAMEVNQQVGGVCGEIAVSQPLPHL
TSLIISTQHYEYKISNVLDKATESCFGFISVLPGAFSAYRFKAIQGAPLDAYFKSLTTDM
LALGPFQGNMYLAEDRILCFELLARKNCSWTMMYVKDAIARTDVPTTLVDLMAQRRRWLN
GSFFAMLYTIFNWGRVYSEARHSLCRGLALLVQYTFMTVQVVFNWFLVANFYLTVYYVIF
YALERNALGVLDTRAFYASHGALAKGLFNVVYGLVFVVQIILGMGNRPKHVARTYRAIGA
YYMLLVVLTTAASVLTLVHTGAAALAPKEIALGIAVFGVYFIAAACHCELHHIVLSFVQY
SLLLPVMINTLTIYRFAICKT

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	174	338	1.8e-47	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.76e-74	170	485	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	2.26e-53	174	338	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	5.14e-26	165	626	53	410	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	8.78e-20	312	480	197	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	5.29e-16	170	435	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACA96933.2|GT2	5.93e-238	26	677	28	672
QKE45457.1|GT2	5.62e-237	26	676	35	681
ADE62520.1|GT2	2.61e-224	27	676	103	736
ARC77249.1|GT2	3.63e-181	14	676	73	734
ARC77250.1|GT2	1.44e-180	14	676	73	734

PDB Hits     

SPRG_19383-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	1.09e-132	137	669	212	726	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P87073|CHS1_PHYB8	9.18e-109	130	681	131	695	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	1.41e-107	130	681	148	716	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30594|CHS1_RHIOL	6.64e-102	130	681	146	711	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30601|CHS2_EXODE	7.14e-102	133	681	220	776	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000007

TMHMM  Annotations     

Start	End
478	497
521	543
563	585
598	620
630	647
654	676