CAZyme Information: SPRG_19298-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_19298-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905		98180.24	9.3411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583192:523079-527544(-)

Full Sequence      

MADTLASAFALMQAGARGEAQERLIALARIAPQNADVHTALGALAQMDGHVDRAIASYAT
ALSLCGPTEALHGNLGLAHYARQDYKASVEHFRAAIALNPARLPDLAHMLGLALHFLRDD
AAAKDMYVAAVAHAPHDAAVRFDYGVTLQALGDIEQAGDAYNRAIALNPAMGSAWLNMAS
LHLQYGEVNKALRGFEKTLGLPLPIDLWLCATTNYAVALELDGQPLAATKFLKRAHAVLQ
LKGATTSTLYLHVCEHQIRTWRAIAYWKDYELVWTRFFEMTWQHEIQVGAVSSMMPFTSL
LLPLAPEMKRKIAESITRPHVSAEKRLWRATPPVAGARRLHVGYLSYDFNNHPTAHLMEG
LFRCHNASSVEVSMLSYGKDDNSSYRRLFPTLVEHFVDLARAGTRAAASVIRDAHVDILI
DAQGHTLGQRHDIVAQQPAPIIINYLVFPGTLGAPYVDYLLADVHVAPPEHAHHFVEKLL
YVPHSYQVNYFASPVPFSETRRTGRFVFANYNKIDKLEPRVFSVWMQILRRVPRSELWLL
APTSTKTEQLTMRHVHMEAAVYGIPPSRIRFLPRVTKAAHLARQADADLFLDTFVYGAHS
TATDAMWGHLPVLTLAGDSFTSRVGISLATNANSVELVVHSAKEFADVADKDWIYDRAMS
SAAEVFTIMAAAVADAGEALVKKVNGSIKFDVKGAGMWLINLKAAPGAVTASNAGEKADL
TITISEPDFVDLINEKLNPQAAFMKGKIKVKGNMGLAMKLSAVTNATKAYLAKQKKSPAA
AAPVAAAPAATSGLKSAALFVGIGEAVKTQGPALVAKVKGTIQFNIAPGGAWFLDLKNGN
GSLETGSKPADLTINVSDEDFMAIADGKLNAQQAFMKGKLKVKGNMGLAMKLNIVIDAAK
PKAKL

Enzyme Prediction     

No EC number prediction in SPRG_19298-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	121	649	2.2e-92	0.5134751773049645

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	5.71e-74	148	645	46	567	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	4.16e-54	267	651	4	509	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
396566	SCP2	1.50e-22	812	892	12	95	SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.
396566	SCP2	1.92e-18	680	763	14	98	SCP-2 sterol transfer family. This domain is involved in binding sterols. It is found in the SCP2 protein, as well as the C-terminus of the enzyme estradiol 17 beta-dehydrogenase EC:1.1.1.62. The UNC-24 protein contains an SPFH domain pfam01145.
276809	TPR	3.57e-13	71	166	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN61861.1|GT41	4.58e-75	70	649	54	611
ALF56607.1|GT41	4.05e-74	339	649	16	327
ALF56465.1|GT41	5.78e-74	339	649	23	334
QCJ91786.1|GT41	8.14e-72	70	649	54	611
QCJ84417.1|GT41	8.14e-72	70	649	54	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A01_A	2.94e-42	267	649	159	651	O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_B O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster],5A01_C O-GlcNAc transferase from Drososphila melanogaster [Drosophila melanogaster]
2JLB_A	2.05e-41	129	628	14	495	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
2VSN_A	3.71e-41	129	628	14	495	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
6Q4M_A	1.06e-40	267	651	161	664	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	1.35e-40	267	651	155	658	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	2.18e-61	258	649	502	908	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	8.17e-40	267	651	479	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|Q27HV0|OGT1_PIG	1.08e-39	267	651	479	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1
sp|P81436|OGT1_RABIT	2.50e-39	267	651	479	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	2.50e-39	267	651	479	982	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000002

TMHMM  Annotations     

There is no transmembrane helices in SPRG_19298-t26_1-p1.