CAZyme Information: SPRG_19242-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_19242-t26_1-p1
• CAZy Family: GT41
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
787	KK583192|CGC2	86161.96	6.6833

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583192:313262-316249(+)

Full Sequence      

MQRLLRVATVLAIFLASAATCKSSSSSSDLLLEGVRLHMDVGALDEAKAIYARVVAENPM
AADAWQLLGAVAVQEGDLPSGEIHFAHALALETDPKKTAMLHCNLAETRRLQKKHDAETL
DHARTGSGVAPTEFCRVVLAKVLLDRSEPRLAIPHLQAVVAARDTHVEAWYLLGRAWLSL
AVLDEAASAFHRLLAAPGPLAVEGYVGLGQVYQTLGVLHEAISYYQRALELHPTHFEGRM
GLATARHQHGRLDDAMHVYASLLEQSPAHVGVLNNLGVALLYRGDGDAAAAYFHRALAIE
PGQLQSLGNLYIYYADLGDVAAARAMAETAYKQSRNDIFRLQAALVLPPVYATHDQLLAT
RAALHASLDAFVADNMALSDFYNTELRPPFYLVYHGKNDRPLLEKLATLYRRAVPQLSWR
APHVATPRPQSCIRVGFMSKSFVTNHAHGLLLRGVLAGLDRAVYCVYLLVVPSVAEAPDP
SLVAAVDHVVPLSLHLLDVQREVAALTLDVLVFADIMSDPVNYFTAFGRLARVQALFWGN
PTTSGNAAIDYFVSSELLDAAMDPEETEDGDHYTEQVVLLPGLGIWYDPPPLPTTPGRRS
DYNLDDHWTIYVCAQSVFKMQPEFDVVLAAILARDLNGHIVLVQGRRATWTAQLVARLRA
TLPRASFERLHLVPRVAGHEAYMRLLSIATVVLHPFPFGGSKTSAEALALGLPLVVRDAT
HLRARMAPATDAYIALALRLGTNATYHAEVAGAITARTPLLWRDKQVVVEWDRFLFNAVR
LSALDET

Enzyme Prediction     

No EC number prediction in SPRG_19242-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	261	758	4.6e-59	0.5304964539007092

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	1.10e-32	250	766	81	602	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
274350	PEP_TPR_lipo	4.67e-15	38	319	441	751	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	5.17e-15	202	298	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
274350	PEP_TPR_lipo	1.75e-11	42	319	343	582	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
276809	TPR	1.77e-11	167	264	1	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAP54338.1|GT41	3.91e-74	340	780	138	587
QGJ68883.1|GT41	2.86e-66	329	777	267	724
QDU48009.1|GT41	1.87e-65	323	787	465	931
QDT25015.1|GT41	1.87e-65	323	787	465	931
QDV15686.1|GT41	4.55e-65	323	787	465	931

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DJS_A	6.78e-08	385	725	105	446	Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_B Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_C Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum],5DJS_D Thermobaculum terrenum O-GlcNAc transferase mutant - K341M [Thermobaculum terrenum]
3Q3E_A	1.56e-06	519	743	361	588	Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3E_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3H_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in complex with UDP-GLC [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_A Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074],3Q3I_B Crystal structure of the Actinobacillus pleuropneumoniae HMW1C glycosyltransferase in the presence of peptide N1131 [Actinobacillus pleuropneumoniae serovar 1 str. 4074]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O82039|SPY_PETHY	3.37e-09	529	760	588	828	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida OX=4102 GN=SPY PE=2 SV=1
sp|Q96301|SPY_ARATH	4.40e-09	429	715	479	761	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
sp|Q8LP10|SPY_EUSER	1.00e-08	529	745	557	779	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum OX=52518 GN=SPY PE=2 SV=1
sp|Q6YZI0|SPY_ORYSJ	2.99e-08	418	750	463	801	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica OX=39947 GN=SPY PE=2 SV=1
sp|O82422|SPY_HORVU	5.20e-08	529	750	574	801	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare OX=4513 GN=SPY PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000486	0.999508	CS pos: 20-21. Pr: 0.9407

TMHMM  Annotations     

There is no transmembrane helices in SPRG_19242-t26_1-p1.