CAZyme Information: SPRG_18436-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_18436-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		38207.67	6.6281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK584385:380-1429(+)

Full Sequence      

MKLFGLVAFAATSSLAQFQDTCSQQLTDAVAECQKSAGIDDLKLFIPAIKDGAGRDNYCG
NAWAGCAKLKLLAPASDCIFWIWKGWSVNPSKELACPADQTTMLCTPNRLAVSEGYGLLY
ANTIQSNTNEQFAYNNETKAIVAKSNGQCLDVYKDNNQFKLHTYACDSKNTNQKWTITNH
KVQHAVHGVCLQADLGHPGAAVGVAPCSGASETNQWFDACDRVPKGYVQLRAATGKNLLE
YNSGLYLNPGGHDFNDIFEWGNGLLKSASNGQCLDVYKDGNGQFKLHTYACDSNNGNQKW
TIANNVVKHATHNNICLDADPTYADSHAQVWECTPNNPNQQWTLLQYSK

Enzyme Prediction     

EC	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.70e-15	140	300	4	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	7.13e-13	188	342	11	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	5.47e-12	145	302	8	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.31e-11	263	344	3	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.18e-10	226	344	1	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55969.1|CBM13	2.08e-176	1	349	1	347
AIG55485.1|CBM13	5.22e-50	97	332	39	277
AIG56171.1|CBM13	1.11e-45	97	332	494	736
AIG56439.1|CBM13	4.87e-44	97	332	491	733
AIG56036.1|CBM13|GH17	4.73e-35	86	331	431	675

PDB Hits     

SPRG_18436-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_18436-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999703	CS pos: 16-17. Pr: 0.9716

TMHMM  Annotations     

There is no transmembrane helices in SPRG_18436-t26_1-p1.