CAZyme Information: SPRG_18351-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_18351-t26_1-p1
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244		25752.67	8.9348

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK584330:1478-2304(+)

Full Sequence      

MKAAAILVATSLAVANATISVPGINYNPRVGPNWGPDATNCKSSAQIDKDFAILAKITKG
VRIYSLTDCNTAELVITAAKKAGLTVWLGLWVGPEPTIFAAEKAKLSSLISSGLVDSTVV
GVHVGSEAVYRKDVTPEKAISNFKEIKAVLTTAKINLPVTIADIGDTWIANPSMVEAVDV
VSANQFPFWENKNANDAAAWFYMRMEPLIASATKYKKKILISETGWATGGSAVNTGPTTP
AQAA

Enzyme Prediction     

No EC number prediction in SPRG_18351-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	1.88e-39	3	244	15	259	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.79e-04	23	235	2	245	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56195.1|GH17	3.01e-137	4	244	3	253
AIG56392.1|GH17	9.83e-81	1	244	1	247
AIG55390.1|GH17	8.07e-77	1	231	1	237
AAY53769.1|GH17	2.96e-75	23	244	26	247
AAM18482.1|GH17	1.38e-66	7	244	13	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.12e-23	31	230	39	230	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	8.07e-23	31	230	39	230	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	1.81e-27	22	230	385	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|A1DEV5|BTGC_NEOFI	1.81e-27	22	230	385	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	1.81e-27	22	230	385	597	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	2.04e-26	22	230	352	564	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|A2QN74|BTGC_ASPNC	2.11e-26	22	230	381	593	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000307	0.999654	CS pos: 17-18. Pr: 0.9259

TMHMM  Annotations     

There is no transmembrane helices in SPRG_18351-t26_1-p1.