CAZyme Information: SPRG_17907-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_17907-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
229		25448.79	5.6764

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK584041:19-801(-)

Full Sequence      

MQTTVLVVMWSLLTASAMAAWNALEQASLAACPCAEASLCLPVVSSRRFEVFAFSPAASD
NWRYYDYSVLTTIAWNLDKGLLCHAHAHRVKIVVLHNFEHVDQLCNASAREAWVHATYTA
IVTNYADGVNVDTEAAITRHDHAACLTLLLQELRVELQAHAFTRHAQITFDVAWSPSGID
QRYYDYAGLAAAADYVFVMAYDMRSQLYDHCLAGANSPIAQVQRGLDDY

Enzyme Prediction     

EC	3.2.1.-:18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	82	229	5.4e-17	0.4358108108108108

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119354	GH18_chitobiase	3.55e-57	24	229	11	216	Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes. Chitobiase can only do so if the asparagine that joins the oligosaccharide to protein is previously removed by a glycosylasparaginase. Chitobiase is therefore the final step in the lysosomal degradation of the protein/carbohydrate linkage component of asparagine-linked glycoproteins. The catalytic domain of chitobiase is an eight-stranded alpha/beta barrel fold similar to that of other family 18 glycosyl hydrolases such as hevamine and chitotriosidase.
119349	GH18_chitinase-like	7.35e-13	82	203	57	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	2.01e-11	106	219	88	200	Glyco_18 domain.
226376	YaaH	5.43e-10	87	224	156	298	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
119353	GH18_CFLE_spore_hydrolase	2.84e-09	85	227	54	200	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55971.1|GH18	3.15e-109	20	229	15	237
UIZ27644.1|GH18	1.62e-65	32	229	467	691
CCA16750.1|GH18	1.95e-65	21	229	24	239
CCA27450.1|GH18	5.61e-64	28	229	2	210
UCK81484.1|GH18	3.54e-43	32	229	57	254

PDB Hits     

SPRG_17907-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q01460|DIAC_RAT	1.72e-40	24	229	18	222	Di-N-acetylchitobiase OS=Rattus norvegicus OX=10116 GN=Ctbs PE=1 SV=1
sp|Q8R242|DIAC_MOUSE	2.86e-37	24	229	17	221	Di-N-acetylchitobiase OS=Mus musculus OX=10090 GN=Ctbs PE=1 SV=2
sp|Q01459|DIAC_HUMAN	5.72e-37	32	229	41	237	Di-N-acetylchitobiase OS=Homo sapiens OX=9606 GN=CTBS PE=1 SV=1
sp|Q8T293|DIAC2_DICDI	2.67e-27	32	229	26	224	Probable di-N-acetylchitobiase 2 OS=Dictyostelium discoideum OX=44689 GN=ctbs2 PE=3 SV=1
sp|Q7KWW8|DIAC1_DICDI	5.66e-23	32	229	23	223	Probable di-N-acetylchitobiase 1 OS=Dictyostelium discoideum OX=44689 GN=ctbs1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000386	0.999606	CS pos: 19-20. Pr: 0.9658

TMHMM  Annotations     

There is no transmembrane helices in SPRG_17907-t26_1-p1.