CAZyme Information: SPRG_17307-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_17307-t26_1-p1
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
138		15019.90	7.7498

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583836:8-424(+)

Full Sequence      

MIAVASVMLHVGISMRSQNVVFAANQDSSVSFRPPSPSFNALASDQGALWTFDHVQNTIK
SELTGLCLDAYRGSNGAPVHTYSCSLSNGNQQWQYDPSSKAIKHMIHKGFCLDMDLGSKK
AQLWQCSGGASQQFGYEK

Enzyme Prediction     

No EC number prediction in SPRG_17307-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	46	134	1.9e-17	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	4.13e-20	44	134	34	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.34e-15	49	134	37	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.98e-13	49	134	32	115	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	1.48e-12	58	134	4	81	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.39e-11	61	134	6	79	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55598.1|CBM13	2.36e-57	1	138	387	524
AIG56276.1|CBM13	3.07e-57	5	138	387	520
AIG55519.1|CBM13|GH17	2.84e-30	8	137	419	552
AIG55595.1|CBM13|GH17	1.72e-27	14	126	429	543
AIG56197.1|CBM13|GH17	1.12e-26	4	126	416	534

PDB Hits     

SPRG_17307-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

SPRG_17307-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.895264	0.104765

TMHMM  Annotations     

There is no transmembrane helices in SPRG_17307-t26_1-p1.