CAZyme Information: SPRG_15973-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_15973-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
513	KK583405|CGC1	55043.96	6.6326

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583405:16-2171(-)

Full Sequence      

MAAVLFQIHAAAPLTADDRYVAVVGNVSELGAWDVAKAVPLKKHVGTSTLWEATLEVAMY
ALIEYKYIVLDRAGGLVLWESLPGNRTRVAGGTNVALHKPVTQSSIFVAPAGPVPGPRVP
ELAVNGNTSGHFEHMCCRTNVQDQPYWQVDLLASTPLAKLVLWNRQDMFLDRLVPVWLLL
SNTPFGDVSLEAAKKQALASMRFASAATNFEWPVTTTARYVRVQHEAAHTSLQFAQLQAF
TPTHLAPPVLDGWFGLDNRALGDGQSHIDGQWLAPGATPELRLIFGSFDKKPSVTFTDKV
QRSIYLQARVLGHPSTSIVHAPYSADLRAIDVAMPTPHLDRELLGNALPLPPSLSRGLDH
VSLLTTLPPHVRDELTAKLERISFPDAQPILSIGQDRHHLLLVDAGVVAVTGPTTTQGTT
TFLELGPGAYFGELALVSGANRSAQVVAKGAVTLSRLHRDDFAAVLAAHGLDATSLLAAH
ADGIAASLPLLTTTPSPKTPFVAQDTLQVDDGC

Enzyme Prediction     

No EC number prediction in SPRG_15973-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	119	235	5.7e-19	0.8984375
CBM20	4	87	6e-17	0.8555555555555555

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
237999	CAP_ED	4.75e-17	363	477	1	115	effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels
395557	CBM_20	6.19e-17	3	87	2	82	Starch binding domain.
215006	CBM_2	1.03e-15	3	91	2	87	Starch binding domain.
119437	CBM20	3.88e-14	4	87	2	81	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
197516	cNMP	4.66e-12	363	470	1	107	Cyclic nucleotide-monophosphate binding domain. Catabolite gene activator protein (CAP) is a prokaryotic homologue of eukaryotic cNMP-binding domains, present in ion channels, and cNMP-dependent kinases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQX89615.1|CBM47	6.83e-13	65	238	519	694
SDU43090.1|CBM47|GH29	8.26e-13	89	240	576	725
SDU75777.1|CBM47|GH95	9.99e-13	94	240	924	1064
ABD82964.1|CBM32|CBM47	8.27e-12	89	252	152	309
QNS02235.1|CBM47|GH92	1.61e-11	93	238	911	1052

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MUV_A	2.05e-09	361	462	20	114	M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-GMP bound [Mesorhizobium japonicum MAFF 303099],4MUV_B M. loti cyclic-nucleotide binding domain mutant displaying inverted ligand selectivity, cyclic-GMP bound [Mesorhizobium japonicum MAFF 303099]
1U12_A	3.49e-09	361	462	16	110	Chain A, cyclic nucleotide binding domain [Mesorhizobium japonicum MAFF 303099],1U12_B Chain B, cyclic nucleotide binding domain [Mesorhizobium japonicum MAFF 303099]
1VP6_A	3.49e-09	361	462	16	110	M.loti ion channel cylic nucleotide binding domain [Mesorhizobium loti],1VP6_C M.loti ion channel cylic nucleotide binding domain [Mesorhizobium loti]
3CL1_A	3.64e-09	361	462	18	112	M. loti cyclic-nucleotide binding domain, cyclic-GMP bound [unidentified],3CL1_B M. loti cyclic-nucleotide binding domain, cyclic-GMP bound [unidentified]
2K0G_A	3.80e-09	361	462	20	114	Chain A, Mll3241 protein [unidentified],2KXL_A Solution structure of a bacterial cyclic nucleotide-activated K+ channel binding domain in the unliganded state [Mesorhizobium loti]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q98GN8|CNGK1_RHILO	2.13e-07	361	462	233	327	Cyclic nucleotide-gated potassium channel mll3241 OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=mll3241 PE=1 SV=1
sp|P09456|KAP0_RAT	2.99e-06	308	466	204	359	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar1a PE=1 SV=2
sp|Q9DBC7|KAP0_MOUSE	2.99e-06	308	466	204	359	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus OX=10090 GN=Prkar1a PE=1 SV=3
sp|P00514|KAP0_BOVIN	5.24e-06	308	466	203	358	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR1A PE=1 SV=2
sp|P10644|KAP0_HUMAN	5.25e-06	308	466	204	359	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998738	0.001298

TMHMM  Annotations     

There is no transmembrane helices in SPRG_15973-t26_1-p1.