CAZyme Information: SPRG_15210-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_15210-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		32185.09	7.9025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583406:18701-19606(+)

Full Sequence      

MKLIATAAVLAATISQTEAHGRMVMPPHRGYIGRLPAFKDIPINYSDNGLNAGGIGGTKG
GKHGVCGDPYNGARDHETGGMYGLFPKLGAKAIGACYKPGQTLDLNIQITANHKGFFEFG
ICKLNGKGDKETEECFQTLTQPNGEKQWPLPAGNDFFKMQYNLPKDLKCDGDSHCVLRWW
YAGGNNPGVGIDGQEQFWNCADIYISDSCGSDPKPSPSSQNPTPAPSSNKPSPSSDKPTP
STKPTTKPSTKPTSAPSGNAKKQWEQCGGKGYTGATSCQDGLDCLKQDEWYSQCVPAVRF
G

Enzyme Prediction     

EC	1.14.99.53:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA15	20	203	1.3e-55	0.9948186528497409

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.61e-13	20	203	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
197593	fCBD	1.30e-09	262	295	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi
395595	CBM_1	3.83e-09	263	291	1	29	Fungal cellulose binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO18684.1|AA15|CBM1	1.04e-210	1	301	1	301
KDO22779.1|AA15|CBM1	9.94e-209	1	301	1	301
EQC25497.1|AA15|CBM1	2.04e-202	1	301	1	305
AIG56514.1|AA15|CBM1	1.28e-167	1	296	1	305
AIG56032.1|AA15|CBM1	7.20e-160	1	299	1	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSZ_A	2.71e-26	20	206	1	193	Lytic Polysaccharide Monooxygenase AA15 from Thermobia domestica in the Cu(I) State [Thermobia domestica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2ABX7|CEL6A_PODAN	2.87e-08	259	299	26	66	1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6A PE=1 SV=1
sp|Q9C1S9|GUX6_HUMIN	5.07e-08	259	299	25	65	Exoglucanase-6A OS=Humicola insolens OX=34413 GN=cel6A PE=1 SV=1
sp|G4MPQ7|XYN6_MAGO7	1.85e-07	264	301	22	59	Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL6 PE=3 SV=1
sp|Q8NJ73|XYN6_MAGGR	1.85e-07	264	301	22	59	Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea OX=148305 GN=XYL6 PE=1 SV=1
sp|P46239|GUNF_FUSOX	1.87e-07	264	296	22	54	Putative endoglucanase type F OS=Fusarium oxysporum OX=5507 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000266	0.999718	CS pos: 19-20. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in SPRG_15210-t26_1-p1.