CAZyme Information: SPRG_14449-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_14449-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791		87524.99	7.0410

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583316:52401-54894(+)

Full Sequence      

MSRESTPLLGTPAPPSNGNKRFVYAKVAVGAVLAVSALALFAWSGPSNDAVVHANQTSSL
ATTRTPTTTPRSDPNAPLAEWAGEEMEPPFTKMTNLIVPKLHAPTWKGAIPSNAWWTNFL
IADGHGEHLGEGQVTLTPYTVIGLNRGLQVSYGDDRRVGDNASIQEYFADDLVFSSNPAP
TTRQVVRFDSLHARLEFKRAGHHGTFTALLSRGSPYLSVDYEGMVPSLSLGGPVGAITQV
NGVAVNDKSVVTLTKSHFHFHTRIERNLVQEWLVFFPSNVTLRVDAHTATVQATSFYGIV
RAAIVPQGEKKAEFKALLHRSANVVPVAAAIRVGSAKNTGAVEFAWKTTQMTPNASTIAT
DELLMLAFPHHVDAFGDATGVNVSSVMNTRPDITATSSDFKVLGRYGHRTIKGNLTAVVG
SAWTLLEPLTTTGFFSQRPIDPKRVHEISSALEKDASYRPSASDPYFFGKELARQARLVL
IADQVHNWAVRDSLLAKIEGWLTRWLTLQNHDFFVYDTVWGGVCSSVGIQGMFYMTDFGN
GWYNDHHFHYGYLLYSAAVLGRYKPAFVQAHKAALHTIVRDIANFNIKDPYFPLARHVSW
FDGHSFASGVYVLDGGKSQESVSEAINAYYGVYLLGQVLAMPDLEQFGRVLLAMEMRAAQ
TYWQTTPEIYGDEYAKNQMTGQVGQTKVSYATWFGPVIEHMHLINFMPFTPITEEFFSPE
YVAKEYKVLYDGAVSRKENPMEEIWRGYAFLDHAIIDPAAAWNEVQTLKTYDDGNSRSNS
LYWIATRPTKP

Enzyme Prediction     

No EC number prediction in SPRG_14449-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	104	783	1.8e-148	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.23e-86	442	781	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	6.70e-75	108	781	88	749	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.03e-28	98	434	3	316	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA19047.1|GH81	5.75e-190	88	787	71	815
AGP40408.1|GH81	4.77e-118	85	788	55	702
CAN97272.1|GH81	5.59e-117	85	788	71	718
AUX36386.1|GH81	3.73e-116	85	788	66	713
UIZ24045.1|GH81	1.25e-111	86	584	74	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.70e-56	101	788	31	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.28e-55	101	788	56	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.09e-54	102	788	32	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.68e-38	406	784	279	653	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.92e-26	395	784	291	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.89e-52	62	785	169	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.14e-48	175	785	157	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	7.61e-43	110	778	35	693	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.42e-40	108	781	432	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q12168|ENG2_YEAST	1.45e-37	364	763	355	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999947	0.000086

TMHMM  Annotations     

Start	End
21	43