CAZyme Information: SPRG_14361-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_14361-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344	KK583313|CGC1	39663.51	5.8515

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583313:52513-53676(+)

Full Sequence      

MRLALAASIASLVVGEDLRYQTNALAYMPRPGLNAIEAALGPTFQRSSSSLSATRPRRFA
FFAGSTPRAIKETWGQRCTKLLFMSNVEDDEIPTVRVVAPATHDHLWQKHRFVVRLLARE
YDASEYDWIFKCDDDTYVIMDNLLSYLHSVATSMASPDEPTLLGHRMTLQWFEMQKPFHD
LSYMQRDRRRALETVLRETRNQGGLYYTPGGAGYAFNSAYLTQLVAALDEPSCLPDEVVP
DDWAISFCMYHRGVVPTDTRDSLHRERFHQYSPEQVYYWPDDVNDFDHWNYASIYDAQNW
FSDHIGIGWRNGSDCCAPDSVSFHYVHDMHLVDAYFELRKNAPK

Enzyme Prediction     

No EC number prediction in SPRG_14361-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	4.07e-08	70	305	24	244	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56499.1|GT31	2.86e-171	1	340	1	360
UIZ24342.1|GT31	9.50e-110	69	337	72	339
AIG55580.1|GT31	2.08e-109	3	336	9	341
CCA20921.1|GT31	1.74e-107	70	336	29	297
AIG55842.1|GT31	6.76e-50	68	333	71	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7Q4I_A	5.15e-28	68	333	45	263	Chain A, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster],7Q4I_B Chain B, Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7K237|C1GLT_DROME	8.29e-27	68	333	117	335	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=C1GalTA PE=2 SV=1
sp|Q5F3G7|C1GLT_CHICK	1.16e-26	68	339	106	328	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Gallus gallus OX=9031 GN=C1GALT1 PE=2 SV=1
sp|Q18515|C1GLT_CAEEL	2.05e-25	70	327	124	332	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=C38H2.2 PE=2 SV=2
sp|Q9NS00|C1GLT_HUMAN	3.55e-24	70	326	107	311	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=C1GALT1 PE=1 SV=1
sp|Q08BL3|C1GTA_DANRE	8.31e-24	65	326	107	315	Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A OS=Danio rerio OX=7955 GN=c1galt1a PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.828627	0.171383

TMHMM  Annotations     

There is no transmembrane helices in SPRG_14361-t26_1-p1.