CAZyme Information: SPRG_13862-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_13862-t26_1-p1
• CAZy Family: GT105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		39790.81	5.7488

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583296:89145-90503(+)

Full Sequence      

MAKCHWWPLFGAAIIITGGAFAITYFTHTGVFAESSSSSSNDPGKPAGKPTKNATCPYRG
YYANSKNDCVACPTPTKTFAVFWQTYTDGCLDFVKSDAFQYITHIYWGFALINNQTGEVS
QTFQGNDATLQTCVNAMKKKCVKQYASIGGQTERANFLSLDTPAKIAAFGKSAAALVQKF
GFDGIDVDDESGNLLAKGDWKTNASPNVASYLQSLRTNLDALPRKSQEPAYGLTWDEFFT
SMDPTCNAPTGDYQRCFDPALASLVDEVNIMAYNAETGVTYDTLLTTTVPTLWTAAIPPA
KLIMGGCVGTPKDQGACSYGASPTSAQLVGYATDGAAKYGGTMLWTASTDIQLNKGANMI
GMGKAGNYGISLA

Enzyme Prediction     

EC	3.2.1.14:12	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	91	305	3.4e-22	0.5777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	1.07e-18	83	350	8	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	4.33e-16	79	274	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	1.60e-14	83	305	9	232	Glyco_18 domain.
395573	Glyco_hydro_18	2.50e-14	83	274	9	176	Glycosyl hydrolases family 18.
119358	GH18_plant_chitinase_class_V	5.41e-12	99	305	23	235	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55900.1|GH18	3.36e-104	53	333	59	337
AIG56010.1|GH18	1.53e-62	55	372	66	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KZ6_A	1.22e-08	113	282	48	212	1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis],5KZ6_B 1.25 Angstrom Crystal Structure of Chitinase from Bacillus anthracis. [Bacillus anthracis]
3N11_A	1.60e-08	113	282	45	209	Crystal stricture of wild-type chitinase from Bacillus cereus NCTU2 [Bacillus cereus],3N12_A Crystal stricture of chitinase in complex with zinc atoms from Bacillus cereus NCTU2 [Bacillus cereus]
3N15_A	3.82e-08	113	282	45	209	Crystal stricture of E145Q chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
3N17_A	1.21e-07	113	282	45	209	Crystal stricture of E145Q/Y227F chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]
3N13_A	1.61e-07	113	282	45	209	Crystal stricture of D143A chitinase in complex with NAG from Bacillus cereus NCTU2 [Bacillus cereus]

Swiss-Prot Hits     

SPRG_13862-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.929205	0.070814

TMHMM  Annotations     

Start	End
7	29