CAZyme Information: SPRG_13822-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_13822-t26_1-p1
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		52740.78	4.1878

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583295:95939-97468(+)

Full Sequence      

MQLSTILLWFLPVALGNLCVVPPYSYTSNSDPALATALSVLQQSPIGTWVNDNGHNPVPG
VLSKCGNGDVPIFVIYGLPNKDCAAGYSGGGTNKNTEQYTSWLQTIVSAVGSREVIYIVE
PDALGLLSQQGCAVNLAYELNLKTAVTVLSQNTNAHIYVDVAGWATESVAISVLQTLKSA
GRLAGISINTSNYQSNDAMLRVCSTYSSATGGLHCVIDTSRNYRGSPQNEWCNAKSAGIG
APPTDTTNHALVDYYLWLKVPGESDGQCTDSGRSSDAMAGPGAGQFFPQGFTSLWNNGYY
VAQGAAPIGGAPPQATAAPVPAPPPATTAPEVTPAPETTQTPASSTPTPTPTTDAPTTPT
TDAPTTPTTDAPTSSTTEAPTYPTHELDNDDDEYPCEIDESDVATMPPRTTPPPPTETKA
ENVTTPAPAAVNLAAAMQSDAAVEAPPTLLSPGGTVAIALAAIALVALVVVSVFSVRRHR
NRFGDRDDNVVALDSTGIAVLLSTPAAKL

Enzyme Prediction     

No EC number prediction in SPRG_13822-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	27	269	2e-57	0.9421768707482994

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	1.91e-47	31	272	1	291	Glycosyl hydrolases family 6.
227616	CelA1	2.23e-23	58	307	168	448	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55947.1|GH6	6.34e-133	16	303	17	303
AIG55789.1|CBM1|GH6	8.02e-116	23	309	24	306
AIG56131.1|GH6	2.48e-115	23	304	29	306
AIG55792.1|GH6	1.89e-114	21	319	25	322
AIG55493.1|GH6	2.13e-113	14	309	17	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP3_A	1.46e-34	29	297	24	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.46e-34	29	297	24	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	2.33e-34	29	297	45	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	3.83e-34	29	297	24	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	4.19e-33	30	289	22	277	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	3.73e-31	30	289	53	308	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	7.91e-27	28	289	190	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26414|GUNA_THEBI	9.63e-26	30	266	56	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	1.30e-25	68	279	140	353	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|B2ADA5|GH6D_PODAN	1.98e-21	25	287	50	349	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999748	CS pos: 16-17. Pr: 0.9785

TMHMM  Annotations     

Start	End
454	476