CAZyme Information: SPRG_12803-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_12803-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		59576.59	7.4840

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583270:129890-131562(+)

Full Sequence      

MLPRAVLSVLCLAAAALGAPRGVCYDAYNSDSASTHFASIASRFDAVRTYQTWTHNSNLI
DIAARNGLAMYPGIWLRGNGRNPGTVKAVFVGNEDLSNNWNAGAVLDKINQAKGAFRDAG
LGYVRIGTVQTDGDWLHNAWLADHVDVVGVNIYPFFGSHPDSWNNPVKDLDARWTAMTNR
FGNKVLLTETGWPDAGGNVGAHVANWQNAQNYFRSAQAWMDGNKGGELPTYFMYHDNRGK
PSYEGHFALAEPNGQWKFEFNAKKNPPNNNGGNNNNDGDKPSGQFQLITSRGKALREWYG
GLAAKDNNNDAFTKWTYDANAQTLKNEGANKCLDAYMDGNNVKVHLYHCDGNNSNQKWRL
AGGKVIHARFSNVCLDADANDPNEGVQNWACVDNNSNQVFKISTGGSGNGGRVALTVRSF
NRVFAVGSNDQVLFRSPQGSIQSDTNALWTLDGKGLLKSAANGKCLDAWEAKNGGGVHSW
NCDENNANQKWSYDTNTKQLRHAKHSGYCLDMGSENGDRPQLWQCHPANDYWAKFQQFAQ
ES

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	6.68e-20	366	538	5	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	2.11e-17	323	491	4	126	Ricin-type beta-trefoil lectin domain.
227625	Scw11	2.00e-16	20	222	45	271	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	2.84e-15	307	400	32	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	7.08e-14	330	491	10	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56198.1|CBM13|GH17	1.27e-197	12	371	9	380
AIG55519.1|CBM13|GH17	1.60e-173	22	541	19	552
AIG56197.1|CBM13|GH17	2.56e-169	6	538	14	547
AIG55672.1|GH17	3.72e-160	1	347	1	363
AIG56231.1|CBM13|GH17	8.06e-135	10	369	7	365

PDB Hits     

SPRG_12803-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BD29|BTGE_EMENI	3.58e-07	16	243	290	537	Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=btgE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999709	CS pos: 18-19. Pr: 0.9699

TMHMM  Annotations     

There is no transmembrane helices in SPRG_12803-t26_1-p1.