CAZyme Information: SPRG_11743-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_11743-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
540		55514.85	5.2037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583260:8171-9793(+)

Full Sequence      

MNIRSVLAVASAMATSVAAGLCNAVQPVSYSEATKNAAFIPAINELKKHAVGSWYSDRAH
GDQIDALMSQCGNDIPVIVIYGLPNKDCGDGGYSNGGSNKDAAAYASWIQSLVDRVGQKE
VIYVVEPDAIGLISGNACAVANNYEANLKVAIQKISTNAKAHIYVDVAAWSTQKTAVDAL
NRLKSAGRINGIAVDTSNYHGTNEMVSLCQSYSSATGGLHCVIDTSRNSNGSPQNEWCNA
KSAGIGAPPTDQTGNSIVDYYLWLKVPGESDGQCTDSGRTSDAMKGPAAGQFYPEGFQSL
WDKGFFVKSGQPAIGAPQPQPSPQPSPSPSPSPQPSPQPSPASSPAPSPSPSPAPSPSPS
SQYPTPAPSPSPSPAPWTEGPSPSPSSTNAPSPGPWTDAPMTTSVAPSPGPWTDAPVQAE
ASSVTTAPSVTPCTMTPCPSADGSSTPCPGMTTPTPSIRSGTTTLAPAVTANVRSGADEA
SGSGIFGYIMAGVVAVAGVVAVVLIVRVVRRRISDNKRMDYDGRPSQEIVVFTPGGDRIL

Enzyme Prediction     

No EC number prediction in SPRG_11743-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	32	276	9.8e-55	0.9455782312925171

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	2.04e-40	54	278	19	291	Glycosyl hydrolases family 6.
227616	CelA1	1.68e-16	69	289	179	407	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].
282904	Herpes_BLLF1	3.02e-06	380	470	465	563	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
282904	Herpes_BLLF1	2.18e-05	382	462	515	594	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.
282904	Herpes_BLLF1	1.72e-04	378	471	463	557	Herpes virus major outer envelope glycoprotein (BLLF1). This family consists of the BLLF1 viral late glycoprotein, also termed gp350/220. It is the most abundantly expressed glycoprotein in the viral envelope of the Herpesviruses and is the major antigen responsible for stimulating the production of neutralising antibodies in vivo.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55792.1|GH6	3.79e-126	8	319	8	316
AIG55493.1|GH6	1.05e-124	1	315	1	309
AIG55776.1|CBM1|GH6	6.89e-124	1	319	1	319
AIG55492.1|GH6	9.79e-123	1	315	1	309
AIG55789.1|CBM1|GH6	1.07e-121	6	315	3	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TML_A	2.76e-37	52	279	39	273	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
2BOE_X	5.05e-36	52	279	39	273	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
1UP0_A	3.47e-32	69	274	64	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	3.47e-32	69	274	64	270	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	5.46e-32	69	274	85	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26222|GUN2_THEFU	3.29e-35	52	279	70	304	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P07984|GUNA_CELFI	2.01e-28	76	295	236	438	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26414|GUNA_THEBI	3.35e-27	2	272	3	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	1.40e-24	75	272	142	340	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|P33682|GUN1_STRHA	9.62e-21	75	295	98	312	Endoglucanase 1 OS=Streptomyces halstedii OX=1944 GN=celA1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001406	0.998564	CS pos: 24-25. Pr: 0.8812

TMHMM  Annotations     

Start	End
487	509