CAZyme Information: SPRG_11742-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_11742-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	KK583260|CGC3	50958.87	5.2266

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583260:4687-6245(+)

Full Sequence      

MQDAGVGSVYGAFPNFTLPMYYVPRLLAAMALAASAVSAGLCTAVPPVSYAAAAQKPHLK
PVVDVLREYATATWYTDRGGDSISELLSKCAGATPVIVIYGLPGKDCAGHYSSNGGNQSP
ADYARWIDSLVSRVGNTNVIYILEPDAIGNLANNECATQRGYLPNLKVALTKLSSNANAQ
IYADVAGWANQGAAQEVLSNLKSAGRLNGIAINTSNYKDTNTLKSICQAYSSATGGLHCV
FDTSRNYRGSPQSEWCNAKSGGIGAPPGTPTGSSIVDHYLWIKVPGESDGGCDNGTHSSD
ASKGPAAGEFFENHLAQLWDQGYFVSEKGMPKIGGNWGNQPSPQPSPQPSPSTSAPATST
PAPTTETPAPTTETVTPAPTNATTTTPAPTTTTTEEPASVTEAASIAPTTKPMATTAAAN
VVSVQSGGEESSSNGIVIALASLVGVAAVVAAVLAAVVIRKRNLREKDDDMIERDSRGIV
VLVGTSRYSEAVL

Enzyme Prediction     

No EC number prediction in SPRG_11742-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	51	294	1.4e-58	0.9489795918367347

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	9.66e-46	57	298	2	293	Glycosyl hydrolases family 6.
227616	CelA1	2.50e-21	88	336	179	446	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55493.1|GH6	2.19e-117	25	338	2	313
AIG55492.1|GH6	1.07e-114	34	342	14	317
AIG55792.1|GH6	2.24e-114	29	343	6	320
AIG55789.1|CBM1|GH6	8.53e-114	26	334	3	306
AIG55776.1|CBM1|GH6	9.47e-112	23	343	3	317

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1UP2_A	4.14e-33	88	318	64	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	5.71e-33	88	318	64	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	5.71e-33	88	318	64	288	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	9.02e-33	88	318	85	309	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1TML_A	3.12e-31	57	290	24	266	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	1.49e-32	91	318	232	443	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26222|GUN2_THEFU	2.40e-29	57	290	55	297	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P26414|GUNA_THEBI	2.90e-27	57	290	58	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P13933|GUN1_STRSS	1.54e-25	83	303	129	352	Endoglucanase 1 OS=Streptomyces sp. (strain KSM-9) OX=74575 GN=casA PE=1 SV=3
sp|Q0CFP1|CBHC_ASPTN	8.47e-24	59	318	141	460	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.399113	0.600893	CS pos: 51-52. Pr: 0.3531

TMHMM  Annotations     

Start	End
436	458