CAZyme Information: SPRG_10613-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_10613-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
744		86275.45	8.3500

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583245:137824-140423(-)

Full Sequence      

MASERGDSSNFNYGGRRAKSESARFEGLRGFFAWEDETDPAWKAAVMAHGGGVPKFATKA
ECEEFVKAQCAPGSNPDFPNLQHIFTMLVTWNQIRDILLPAMAMVDAKYPYVPHRSPVRP
ENRFVDSAVESGVTWRTELPFHRETNRESTMHTLKYLFFHMRCGIFVMIRAGKVVLFAPF
VNKDYENNWAEFLKFDSSDGSFKAYYEEKRNHYRRENVIPDVRKWWANGNIICNEHCKDN
RQLDETQYWGDQFLAQLRDMLDDCCKHRDLPDCEFFINKRDYPHLKNNLSEPYGFLFDRD
DRNPDEDLPLTQYKFPSYAPIMSFYISNRFADIPFPCSEDWEAATGLVFPPSFQHTHCHH
CPCKNKRNCEANWECFCPGDRKYHGISTVRDLFTASNFKKFDLPWEKKDNTAFFRGTATG
GGTTIDTNQRLHLAHLSNLWKTESEYHHLMHPLPYLDAEITAWNLRDKKIAKNPMTFVRK
ERFQGRGEFTAGKHHYIPMYEQSKYKYILYVEGHCAANRYAFLMRLGGVILKVTSKCVAD
EMWYTPLLQPMVDHVPIKPDLSDLAEKIQWCRDNDDKCREIAARAKWLYDNYVSKEGIHD
YMEMITTQIAQKYVHAPTRFGYVRPREDVQPPSMRPTHPHACVGGSGNQPGRVCRGCKDG
EAEHRSKRQKLEQDDEKYGANKPLQYDNYRQGGGGRGRGRGGGGYNQQSSNSRNSGYQAP
RGPPAEKACRRCRRKISLCMCSRH

Enzyme Prediction     

No EC number prediction in SPRG_10613-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	270	607	1.7e-29	0.96

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	4.50e-23	270	602	2	242	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	1.33e-13	270	619	79	329	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26993.1|GT0	1.16e-303	28	670	7	662
CCA22368.1|GT0	2.80e-149	29	667	10	610
ARF10830.1|GT90	3.24e-105	53	609	24	505
QEA08254.1|GT0	6.14e-67	146	609	81	521
UIB20781.1|GT0	6.14e-67	146	609	81	521

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	1.79e-14	270	619	94	348	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O55767|VF179_IIV6	3.37e-68	146	609	81	521	Uncharacterized protein 179R OS=Invertebrate iridescent virus 6 OX=176652 GN=IIV6-179R PE=4 SV=1
sp|Q197C5|VF179_IIV3	1.76e-53	153	613	96	493	Uncharacterized protein 035R OS=Invertebrate iridescent virus 3 OX=345201 GN=IIV3-035R PE=4 SV=1
sp|Q6GZU9|027R_FRG3G	4.91e-33	153	597	42	430	Uncharacterized protein 027R OS=Frog virus 3 (isolate Goorha) OX=654924 GN=FV3-027R PE=4 SV=1
sp|G3V9D0|PGLT1_RAT	9.02e-16	268	619	120	376	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8BYB9|PGLT1_MOUSE	3.85e-14	267	619	120	376	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000073	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_10613-t26_1-p1.