CAZyme Information: SPRG_10169-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_10169-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
624		67636.23	7.4116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583240:171310-173184(-)

Full Sequence      

MRARLFLLAGLAVASATPIRPSACYSPFHLDAYPLQPWEALDAPALAAGIGEDFAQMKPY
VHTVRTYYSKYHSVDVTPIAAASGVPLYLGVYMVHEPWYWLQVAAAIDGAVAYPETVRAV
LVGNENVAPYGDFEAAYIANQVQHIKSEVANRTNGSITVPVGTVQRITEWLNPAIRTEML
ALADACDVIGVNIYPFFDNSYDALDPTALVTALWDQMLAIYPAHKLRLTETGYSTGGPSS
SVAPLVVPSLDNAIKYYNALMQWTPSRGGGDIFWYSFYDLRDDDTTQPEPLEKHFGYFNA
NGTAKAANFPKPVFPHLVPTTPRKYTTTRKPTTRPLLPTKTPATRSLAPIAPTQTPTPTP
TPTTTPTPAPTLTTATPITLCTFKKTILSEWNGGLYVNKINNNNNEKFLLRTNAGIQSVS
SGNGCLTYNAATNGVSVSACSGAATQAWKFDAAAKRVVYGNLCLQSSPSSPGASPNVAPC
SSGAVSQYFDDCASVPSTTSYVQLVTKRNAFVYEFYNNVYAGANGDDLNHLFKYDAAAKT
LQAMSNGQCFDAYATGSGYALHTFTCNGNNGNQKWIIDAANRKIKHATHPNLCLDVDPTN
ASRRAQVWTCYANSDNQHITVVPY

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	113	305	3.8e-19	0.7234726688102894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.11e-19	53	301	68	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.78e-16	524	618	32	125	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.31e-11	524	618	30	121	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
238092	RICIN	1.47e-11	545	618	8	79	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	7.90e-10	540	618	4	81	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56036.1|CBM13|GH17	1.30e-228	10	624	11	691
AIG56157.1|GH17	1.95e-146	7	305	8	308
AIG55724.1|GH17	3.39e-119	10	310	12	316
AIG56254.1|GH17	4.28e-115	21	319	303	598
AIG55733.1|GH17	2.25e-102	21	273	310	559

PDB Hits     

SPRG_10169-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	6.60e-07	138	290	151	291	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	6.66e-07	138	290	151	291	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	4.69e-06	138	290	151	291	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	6.23e-06	160	290	171	291	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000295	0.999681	CS pos: 16-17. Pr: 0.9406

TMHMM  Annotations     

There is no transmembrane helices in SPRG_10169-t26_1-p1.