CAZyme Information: SPRG_09933-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_09933-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547		59600.32	8.4665

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583244:226805-228618(+)

Full Sequence      

MAAAMLVGAVAWATFANSIGNGFAWDDRGAILTNADVHSDVTPLSNLLWHDFWGGDMHSP
ISHKSFRPLTVLSFRCNYAISGLTPWSFHATNVALHAIASMLVVVVGQRLQRSSRVPVLG
GLLFAVHPIHCDSVASIVGRADILATVFSLAAILAYVPRAAKATPTPRHVASAMFWTLCA
TLCKENGATTFGILLVLECARAHEASPRRLAALTGTLVLLVCVRVALNGRHTLYVWSKYE
NEFATMQWGVSKWLTIAHLHGWYLFKLLWPQHLCYDYGYQTLPVLDSILDARNGLTLAAY
AALACVLVCAIRSPWPSPLRAYVALGVCPFVPAANVLFPVGTVLAERLLYFPSVGFCLVL
GLILDAATGVARAVSRNRDWHSEHSLFASALTVSPSSVKVLTNVAKELLASDPPRAAMYL
ERAVMLLPTYSLAHLNLAAAYGKYDAAFGKPLHSMHHLIQSCELDRSSLAYASLGLRLVE
FVARHGDAIPAARRRNILEKAESFVWDAIAVTPLVPSAYYTLGLAAYYRDAYDEALQYVA
TGPIFWS

Enzyme Prediction     

EC	2.4.1.109:6

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	77	203	3.9e-35	0.9236641221374046

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	2.40e-06	235	293	5	63	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	1.09e-04	386	447	23	88	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	0.002	398	476	1	77	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	0.006	433	538	3	91	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE38405.1|GT105	5.56e-68	6	523	16	575
BAC32122.1|GT105	2.90e-67	6	523	16	575
CAB4055299.1|GT105	5.32e-65	15	523	129	687
CAF2772550.1|GT105	5.32e-65	15	523	129	687
CAG26973.1|GT105|2.4.1.109	1.09e-64	5	523	11	570

PDB Hits     

SPRG_09933-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BRH0|TMTC3_MOUSE	4.46e-67	6	523	16	575	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	1.95e-65	5	523	11	570	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q5T4D3|TMTC4_HUMAN	8.30e-58	3	418	22	502	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q8BG19|TMTC4_MOUSE	1.08e-56	3	418	21	502	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q9VQE9|TMTC1_DROME	1.75e-50	9	437	28	558	Protein O-mannosyl-transferase TMTC1 OS=Drosophila melanogaster OX=7227 GN=CG31690 PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.467135	0.532874	CS pos: 16-17. Pr: 0.3160

TMHMM  Annotations     

Start	End
294	316
323	345
349	371
503	525