CAZyme Information: SPRG_09552-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_09552-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	KK583237|CGC2	55984.64	4.9685

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583237:113359-114897(+)

Full Sequence      

MGVISKLLAAACVVAPCVARDGLKNVVYFMEWSIYARNFHIFDLDWSRITHVNYAFGKPN
ADGTVQLYDTWSATDKRYIDHGDSWNDLGNNVYGQFGHANKMKKTHRHAKFGLSIGGWTL
SGLFSGFAATEMGRRTFASSAVQLMLDLGLDFIDIDWEYPVAGGNAIPHAPDDMANFVLL
LQAIRDAYASLPFLAELSVASPAGPENYAHWDFPSVCGLVDHVNLMAYDLAGSWSEYTDY
QNNLFADPQHPSGKQYSIDRAVQDYITGGCPSEKIVMGIPLYGRSFENSHGLYTPFAAPT
AGSWVAGSDGAGVWDYKVLPRPGATELYDEKLGAGYSYDANARVFTSYETPRSLAAKLEY
IEKYNLGGTMFWAGDADAPLTSGRSLIAQAHDHFGRDKMALYDNNVAYPTSKYANIRNSS
STGTEAPVVAPTVVETTALPATTDAPDEEAEDETEAPATEAPTPTVAPRRPSSSACAGYR
NTCFWPLTMTKLPLAYTKSDCNKFKGTFVWCP

Enzyme Prediction     

No EC number prediction in SPRG_09552-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	24	379	6.4e-70	0.9391891891891891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	4.20e-112	25	377	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	5.46e-104	24	377	1	334	Glyco_18 domain.
225862	ChiA	7.72e-83	24	395	39	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
395573	Glyco_hydro_18	1.65e-78	24	377	1	307	Glycosyl hydrolases family 18.
119351	GH18_chitolectin_chitotriosidase	9.42e-75	26	377	2	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56034.1|GH18	2.85e-282	8	512	7	502
ACJ04636.1|GH18	3.42e-217	4	512	2	522
ACJ66260.1|GH18	3.42e-217	4	512	2	522
AIG55712.1|GH18	2.98e-216	3	512	4	514
AIG56062.1|GH18	3.32e-215	1	512	1	513

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EPB_A	9.72e-101	21	418	36	420	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	1.21e-98	21	418	36	420	Chain A, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]
1D2K_A	7.32e-98	22	418	2	388	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	2.06e-97	22	418	2	388	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	4.10e-97	22	418	2	388	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	1.80e-106	21	417	36	419	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	2.32e-101	1	417	9	420	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|A6N6J0|CHI46_TRIHA	3.11e-100	21	418	37	427	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P48827|CHI42_TRIHA	1.41e-99	21	418	36	420	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	1.97e-97	19	418	34	423	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.031406	0.968556	CS pos: 19-20. Pr: 0.9057

TMHMM  Annotations     

There is no transmembrane helices in SPRG_09552-t26_1-p1.