CAZyme Information: SPRG_09497-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_09497-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
775		85929.09	6.7193

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583234:247952-250378(+)

Full Sequence      

MARREKTAKASTDAPKATWAPAAFRTSTSTTPSDRVFAGALLGAICVLAVAIRLFSVVKW
GRVIHEYDPQFNFRTSKFLATNSFSEFLNWFDDRAWYPLGRVVGGTLYPGLMLISPSVYR
AMHFVGFPISILDVCVYFAPFFAAATAVATYGLATHITKEPRTGLLAAFFISIAPAYISR
SVGGSYDNEGVAIFLLVLVFYLWVKSVDSGSMVDAALTAGAYFAMVLSWGGYVFLINVIP
IHVLVLVLSGRYTPNLYIAYCTFYILATILAMQVPFVGFNVIQKAECIGSHGVFGGLQVF
AFGKYLQSHLSSSLSATQVRQLITTAGAGLVGLVALLALLLQLTGKLQWTGRSLTLLDPT
YASKYIPIIASVSEHQPTSWAAFYMSFGPVLLVMPLGLYYIFAAKHELTPGAFFLIVYST
LSWYFAGIMNRLVLTLAPAACVVAAIGVSGLLDRVFFVMKRDEHESVMDASGFFNEDDDI
KADKLQKIKDAQRLHPHAMPEGDDAIADLFSFTYSAVHLEPQALPERKSPGMIMAFVGTT
TMLLMWQLFHCSSISSKAYSSTSLVHEQVNRTTWEFTVHDDFREAFAWLRHNTPEDARVL
SWWDYGYQISSLANRTVLVDNNTWNNTHIATVGRVFASTEEEAVPILQSLDVDYVLLLFG
GVSAFDGDDLDKFTWFLRIAQGVFPDSVDIGRFEVNGGVQVTPGATEAMEQCVLYKLSYY
RFEGMTPEFKQPPGYDTNRNARVRSAPIDLTHFDEVFTSNGWIVRIFQVKKHLLQ

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	41	722	2.9e-152	0.8427128427128427

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	1.68e-84	36	494	1	451	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	4.27e-50	41	775	21	735	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
275016	archaeo_STT3	2.51e-06	40	655	2	584	oligosaccharyl transferase, archaeosortase A system-associated. Members of this protein family occur, one to three members per genome, in the same species of Euryarchaeota as contain the predicted protein-sorting enzyme archaeosortase (TIGR04125) and its cognate protein-sorting signal PGF-CTERM (TIGR04126).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23018.1|GT66	7.67e-249	40	771	65	738
CCA15036.1|GT66	3.07e-247	41	771	65	737
CCA23157.1|GT66	3.07e-247	41	771	65	737
AFJ69334.1|GT66	7.41e-243	41	769	67	747
CCA17694.1|GT66	4.83e-212	41	769	8	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTJ_5	9.04e-208	41	770	22	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6FTG_5	1.22e-207	41	770	22	695	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	2.44e-207	41	770	22	695	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	7.80e-195	53	770	88	773	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6C26_A	1.36e-181	49	771	28	684	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5RCE2|STT3A_PONAB	1.25e-206	41	770	22	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1
sp|F1PJP5|STT3A_CANLF	1.25e-206	41	770	22	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
sp|P46977|STT3A_HUMAN	1.25e-206	41	770	22	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|P46978|STT3A_MOUSE	1.77e-206	41	770	22	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
sp|Q2KJI2|STT3A_BOVIN	7.11e-206	41	770	22	695	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000039

TMHMM  Annotations     

Start	End
36	58
97	119
124	146
161	183
190	207
227	249
256	278
321	343
381	403
408	425
432	451