CAZyme Information: SPRG_08628-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_08628-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
576		63676.15	7.7092

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583227:98799-100529(-)

Full Sequence      

MKVPSSLPLLALCLASSAALDRSLWGMNYDTRTSEWGGCKDQAVITADLTALKTVTNVVR
LYSMKQPCLDRVLKSAKNLGLKVWIGTWSEVASPKVRDSFNEDFKVLQSLVKSGAITNQN
VVGLQVSSEALFRYYINGGAGVNDTANTNGVDAMIAHLNQTRTFLRQNKLDFPVTIADVM
DIYNNYPKLYNAVDVVSVNQFSMWENVEPANGAFTMWQHWQKVEALARAAGKPVLMSETG
WSSAGNNTAIKEASPEAERIFTRDFLTVAEQMQMNYFYFASFDLSFGDNIIERNFGIFDV
DRKMKDPIVKANVGKAPIAVRLFAGNKVLKADGYLTSTYTRLSMDTPATGAGLDSEIWFW
DPTTSVLRSKSANQCLDSYGSNDWQNVHLWNCDFTNKNQKWKIENNAVKTQNGANFCMDS
DPSMTYDDGKQKVQMWWCWNGPNQKITMRPIGAEPIQIKLGGKAWLSASGAAVSTNAQTS
ASWFYDPIAQTLSTKEKTCLDLATYARDMPVKATACVANSATQKWQFNDVTGQFNHGTSL
ALCLSGSAKTADVVAQLCDKTDANQKWVVSMTNPTA

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	26	305	4.6e-18	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.13e-24	15	302	36	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
238092	RICIN	1.60e-11	367	445	46	121	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	1.84e-11	367	445	48	125	Ricin-type beta-trefoil lectin domain.
214672	RICIN	1.63e-09	357	445	32	114	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.
395527	Ricin_B_lectin	6.44e-09	483	567	40	126	Ricin-type beta-trefoil lectin domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55960.1|CBM13|GH17	0.0	1	576	1	576
AIG55545.1|CBM13|GH17	0.0	14	576	11	575
AIG56029.1|CBM13|GH17	1.32e-163	1	576	1	566
AIG56030.1|CBM13|GH17	4.15e-162	11	571	13	575
AIG55846.1|CBM13|GH17	3.87e-126	10	570	14	565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.41e-22	22	308	35	292	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.49e-21	22	308	35	292	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	2.81e-15	20	305	387	674	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.81e-15	20	305	387	674	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999772	CS pos: 19-20. Pr: 0.9595

TMHMM  Annotations     

There is no transmembrane helices in SPRG_08628-t26_1-p1.