CAZyme Information: SPRG_08368-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_08368-t26_1-p1
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	KK583225|CGC1	43141.32	6.8757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583225:165535-166689(-)

Full Sequence      

MHDDVVTVVKARRRGCKPYAGFCVLIATMLVMFLTLALHLPSTRLHHAAPLTSRKATPEP
AAIYEQEALSSTLEPISFTMQARASSLTTPAPPASSRNASSTPIIESVIPRILHQSWKSA
DAIPEIFAPWMRSWVQHHPTWTYVFWDDAANLALFARHYPQYYAVASSVGKIHLADMTRY
ALLHRFGGVYVDCDFESTSPLDDLLDKDLFLSTEPFVHAVLLERATDAILCNAVLASRRG
HPFWLQVLDAILAKFQAGGAKQDPVSLTGPRLVEAVYHEFDAERVGASVTVFPEEYFYPE
IAYWNLGRLLELCRDRFDPLGRKACNWLRDHPKGFYTPRTHAVHHWQCTWCRGDVGEAVT
TLSAIFPTATIHRPLRGDDDDGLF

Enzyme Prediction     

No EC number prediction in SPRG_08368-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	130	207	9.3e-16	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.54e-15	109	292	82	255	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.08e-08	132	196	9	78	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ26039.1|GT32	3.13e-35	106	350	11	288
UPR05240.1|GT32	3.13e-35	106	350	11	288
AUN93720.1|GT2|GT32|GT62	3.57e-34	108	354	1	227
AQW50986.1|GT2|GT32|GT62	4.20e-33	112	356	10	230
QKV94207.1|GT2|GT32|GT62	5.58e-33	106	350	4	225

PDB Hits     

SPRG_08368-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	2.74e-16	107	248	55	185	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|P38287|CSH1_YEAST	2.20e-13	108	251	61	193	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	3.58e-13	109	255	64	202	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.93e-12	106	249	79	211	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P33300|SUR1_YEAST	1.02e-11	108	291	54	227	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000005

TMHMM  Annotations     

Start	End
21	43