CAZyme Information: SPRG_08089-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_08089-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		42407.49	7.6015

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583221:158664-159833(+)

Full Sequence      

MFKTLFLGLAATIASVASMGICYDTYDYKNIDSHFSTLAGRFSTVRTFQTYIYSDSRNVI
DAASDHGLGIYAGVWIRDGMDFNKEIQAVIDGYKRHPNTVKAVFVGNEDLENGWNQWQVI
DKINDAKGRFKAAGVNVRVGSVQTDGGWLRSQDLYNACDIVGVNIYEFFGGSHEDRWNAV
VKKYGGSKLMITETGWPFGGGNYGNQVASFDNAVKHFNKVRSWMSAGHGGEDVMYFMFHD
NKGKSPDYEKQFGLADASGKWKFDFSGAGPAPQPNPQPNPQPNPQPNPQPNPSPAPQPNP
SPAPQPNPSPAPPSDKKCGGVEWNTDYPGNDMFNFAMAGDMGSLMNKCCGKCLSTSGCAG
YAILNSRCYIKSALGEKKGASGVTTMRLQ

Enzyme Prediction     

No EC number prediction in SPRG_08089-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	9.75e-21	20	258	57	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	2.38e-06	19	265	1	309	Glycosyl hydrolases family 17.
405052	PAN_4	0.006	325	371	1	51	PAN domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56512.1|GH17	3.35e-187	1	388	1	391
AIG56486.1|GH17	7.57e-167	10	389	10	342
AIG56485.1|GH17	7.66e-166	9	389	9	348
AIG55519.1|CBM13|GH17	4.61e-120	11	265	10	271
AIG56231.1|CBM13|GH17	6.32e-113	9	272	8	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.88e-09	30	254	54	281	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.08e-08	30	254	54	281	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	1.02e-10	58	258	438	670	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	2.39e-10	58	258	438	670	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	2.39e-10	58	258	438	670	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q2U492|BTGC_ASPOR	3.17e-10	29	262	404	671	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1
sp|B8NTP7|BTGC_ASPFN	3.17e-10	29	262	404	671	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000429	0.999534	CS pos: 18-19. Pr: 0.9527

TMHMM  Annotations     

There is no transmembrane helices in SPRG_08089-t26_1-p1.