CAZyme Information: SPRG_08087-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_08087-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36506.53	6.6785

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583221:153023-154000(+)

Full Sequence      

MGACYDTYDFKNIDYHFDVMRQRFSTVRTFQTYIYSNSRNVIDAASDHGLGIYAGVWIRG
PDYDKDVQAVIDGYYRHPNALKAVFVGNEDLENGWNQWQVIDKVNDVRNRLRAAGVNVRV
GSVQTDGGWLRARDLYNACDIVGVNIYAFFGGTLEDRWTHMVNTYGGSKLMITETGWPFG
GGNYGNQVASFDNAVKHFHRVADWVRAGNGGEDVMYFMFHDNHGKWPEYEKQFGLANAAG
QWKFDFSTPVKGSCSAPEWNTDYEGNDLFNFAISGDMNSLIAQCCAKCTSTSNCGGYSIF
ENRCYIKSAMTGRKGANGVTSARRQ

Enzyme Prediction     

No EC number prediction in SPRG_08087-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.29e-19	25	238	77	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.12e-05	142	245	200	306	Glycosyl hydrolases family 17.
238533	APPLE_Factor_XI_like	2.02e-04	250	320	1	69	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56486.1|GH17	3.30e-198	1	325	19	342
AIG56485.1|GH17	8.43e-184	1	325	19	348
AIG56512.1|GH17	1.22e-170	1	323	20	390
AIG56231.1|CBM13|GH17	3.54e-108	1	252	18	271
AIG55519.1|CBM13|GH17	6.20e-107	1	248	18	273

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.56e-14	17	221	59	268	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.31e-13	17	221	59	268	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WUK5|BTGC_ASPFU	4.25e-10	40	256	438	687	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	4.25e-10	40	256	438	687	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	9.95e-09	12	256	375	654	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|A1DEV5|BTGC_NEOFI	1.35e-08	40	256	438	687	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|Q04951|SCW10_YEAST	7.27e-07	36	238	177	388	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in SPRG_08087-t26_1-p1.