CAZyme Information: SPRG_07825-t26_1-p1

Basic Information

• Species: Saprolegnia parasitica
• Lineage: Oomycota; NA; ; Saprolegniaceae; Saprolegnia; Saprolegnia parasitica
• CAZyme ID: SPRG_07825-t26_1-p1
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	KK583219|CGC2	36301.16	6.1199

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_SparasiticaCBS223-65	20435	695850	314	20121

• Gene Location: location=KK583219:207927-209042(-)

Full Sequence      

MVSASTLVGLALVASQVAAHGGLFDPKPTFLEPNSDPTRFCGTIDGPTSLPGSAYNQDPG
YNAAQFAANFKTSKYKTLKAFLDAWDTSAQCGQCGITKVDAANPQPLPSIVKWRHGDNEG
FTPSHEGPCELWCDETRVYYNDDCAKNIPDGSMPIDTSKCAGAKQLTMLWMALHTPQWQA
YKNCVAIGSAGPSPSTSKPSPSTNKPNPSTNKPGPSTKAPTPAPTAEYPTDKPTTAPTTK
PTTKPSTKPSTKPSSKPTDKPSGGKVALYYQCGGTNYKGDTQCVDGARCVKYNEYYYQCR
PSSEPKSDYESLESTATDDDDDETYDDDDTTRRLRRV

Enzyme Prediction     

No EC number prediction in SPRG_07825-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	11	258	1.1e-77	0.9428571428571428

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395595	CBM_1	1.37e-09	268	296	1	29	Fungal cellulose binding domain.
197593	fCBD	1.79e-08	267	300	1	34	Fungal-type cellulose-binding domain. Small four-cysteine cellulose-binding domain of fungi

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KDO27114.1|AA17|CBM1	2.30e-200	1	337	1	337
EQC42132.1|AA17|CBM1	4.11e-179	6	315	5	310
KDO27115.1|AA17	5.81e-148	1	198	1	198
AIG55793.1|AA17|CBM1	1.73e-109	4	304	5	315
AIG55790.1|AA17|CBM1	6.77e-97	7	304	3	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	5.82e-11	125	187	96	170	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2US83|EGLD_ASPOR	7.34e-09	262	299	327	364	Probable endo-beta-1,4-glucanase D OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglD PE=3 SV=1
sp|B8MXJ7|EGLD_ASPFN	7.34e-09	262	299	327	364	Probable endo-beta-1,4-glucanase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=eglD PE=3 SV=1
sp|Q5BCX8|EGLD_EMENI	4.10e-06	264	299	319	354	Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglD PE=1 SV=1
sp|I1S3C6|XYND_GIBZE	5.79e-06	267	304	19	56	Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYLD PE=1 SV=1
sp|G0RV93|GCE_HYPJQ	6.61e-06	268	307	21	60	4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) OX=431241 GN=cip2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999644	CS pos: 19-20. Pr: 0.9783

TMHMM  Annotations     

There is no transmembrane helices in SPRG_07825-t26_1-p1.